MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint sumiyoshi-2015-2 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Sumiyoshi M., Masuda N., Tanuma N., Ogoh H., Imai E., Otsuka M., Hayakawa N., Ohno K., Matsui Y., Hara K., Gotoh R., Suzuki M., Rai S., Tanaka H., Matsumura I., Shima H., Watanabe T. toshiwatana@cc.nara-wu.ac.jp FEBS letters 2015 Only protein-protein interactions imex curation imex curation sumiyoshi-2015-1 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sumiyoshi M., Masuda N., Tanuma N., Ogoh H., Imai E., Otsuka M., Hayakawa N., Ohno K., Matsui Y., Hara K., Gotoh R., Suzuki M., Rai S., Tanaka H., Matsumura I., Shima H., Watanabe T. toshiwatana@cc.nara-wu.ac.jp FEBS letters 2015 Only protein-protein interactions imex curation imex curation sumiyoshi-2015-3 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sumiyoshi M., Masuda N., Tanuma N., Ogoh H., Imai E., Otsuka M., Hayakawa N., Ohno K., Matsui Y., Hara K., Gotoh R., Suzuki M., Rai S., Tanaka H., Matsumura I., Shima H., Watanabe T. toshiwatana@cc.nara-wu.ac.jp FEBS letters 2015 Only protein-protein interactions imex curation imex curation smap1_mouse Stromal membrane-associated protein 1 Smap1 protein protein mouse Mus musculus Mouse MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNKEKEKKKDEKKREKEPEKPAKPLTTEKLPKKEEQQLEPKKSTSPKNAAEPTIDLLGLDGPAEAPVTNGNPATAPALSDDLDIFGPMISNPLPAAVMPPAQGTASVPAPATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSILSLYGTGAQQSTPGVFMGPTNIPFTSQAPTAFQGFPSMGVPVPAAPGLIGNMMGQNTGMMVGMPMHNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWNLSQMNQQMAAMNLSSANASAGFGQPPSTTAGWSGSSSGQTLSTQLWK mint GTPase activating protein that acts on ARF6. Plays a role in clathrin-dependent endocytosis. May play a role in erythropoiesis smap2_mouse Stromal membrane-associated protein 2 Smap2 Smap1l Stromal membrane-associated protein 1-like protein protein mouse Mus musculus Mouse MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINVLRKEKDDKWKRGNEPAPEKKMEPVVFEKVKMPQKKEDAQLPRKSSPKSAAPVMDLLGLDAPVACSIANSKTSNALEKDLDLLASVPSPSSVSRKAVGSMPTAGSAGSVPENLNLFPEPGSKSEETGKKQLSKDSILSLYGSQTPQMPAQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGGMVPPPVGMVAQPGASGMLTPMAMPAGYMGGMQASMMGVPNGMMTTQQAGYMASMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMGGGNGQAANQTLSPQMWK 1-77 1882956 N/A 1882959 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1882960 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f2a smap1-smap2-1 1882956 N/A 1882959 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1882960 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f2b 1-76 1882957 N/A 1882959 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 1882960 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f1 1-78 1882958 N/A 1882959 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1882960 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2c