UniProt UniProt http://www.uniprot.org gilpin-2015-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu human fetal brain cDNA Human molecular genetics 2015 IMEx imex curation Only protein-protein interactions gilpin-2015-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu human fetal brain cDNA Human molecular genetics 2015 IMEx imex curation Only protein-protein interactions gilpin-2015-3 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu Human molecular genetics 2015 IMEx imex curation Only protein-protein interactions gilpin-2015-4 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu Human molecular genetics 2015 IMEx imex curation Only protein-protein interactions gilpin-2015-5 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu Human molecular genetics 2015 IMEx imex curation Only protein-protein interactions gilpin-2015-6 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gilpin KM., Chang L., Monteiro MJ. Sequence coordinates for GNRPU adapted to canonical UniProt form (isoform identity cannot be established from C-terminal clone). CoIP fig 4 omitted as used Ubqln antibody might be not specific. monteiro@umaryland.edu Human molecular genetics 2015 IMEx imex curation Only protein-protein interactions p09651-2 Heterogeneous nuclear ribonucleoprotein A1 HNRNPA1 HNRPA1 Helix-destabilizing protein Single-strand RNA-binding protein hnRNP core protein A1 protein protein human Homo sapiens Human MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF Is twenty times more abundant than isoform A1-B. ubql2_human Ubiquilin-2 UBQLN2 PLIC2 HRIHFB2157 N4BP4 Protein linking IAP with cytoskeleton 2 Ubiquitin-like product Chap1/Dsk2 DSK2 homolog Chap1 protein protein human Homo sapiens Human MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAGTNTTSASTPRSNSTPISTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSSSGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSSNATGNTVAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANPQLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS roa3_human Heterogeneous nuclear ribonucleoprotein A3 HNRPA3 HNRNPA3 protein protein human Homo sapiens Human MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRGGNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPYGGGYGSGGGSGGYGSRRF hnrpu_human Heterogeneous nuclear ribonucleoprotein U HNRNPU SAFA U21.1 HNRPU p120 pp120 C1orf199 GRIP120 Nuclear p120 ribonucleoprotein Scaffold-attachment factor A protein protein human Homo sapiens Human MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSLDLGGDSAGRSGAGLEQEAAAGGDEEEEEEEEEEEGISALDGDQMELGEENGAAGAADSGPMEEEEAASEDENGDDQGFQEGEDELGDEEEGAGDENGHGEQQPQPPATQQQQPQQQRGAAKEAAGKSSGPTSLFAVTVAPPGARQGQQQAGGKKKAEGGGGGGRPGAPAAGDGKTEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELSYAKNGQDLGVAFKISKEVLAGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTFIQNVPLEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY ubql1_human Ubiquilin-1 Protein linking IAP with cytoskeleton 1 UBQLN1 DA41 PLIC1 protein protein human Homo sapiens Human MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLNNPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQLQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS roa1_human Heterogeneous nuclear ribonucleoprotein A1 HNRNPA1 HNRPA1 Helix-destabilizing protein Single-strand RNA-binding protein hnRNP core protein A1 protein protein human Homo sapiens Human MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF ubqln2-hnrnpa1-1 1860293 N/A 1860299 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1860300 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1860309 1860307 physical association physical association false false false 1A and B ubqln2-hnrnpa3-1 1860293 N/A 1860301 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1860300 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1860314 1860312 physical association physical association false false false 1A and B ubqln2-hnrnpu-1 1860293 N/A 1860302 unspecified role unspecified role prey prey N/A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1860300 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1860319 1860317 physical association physical association false false false 1A and B ubqln2-hnrnpa1-2 1860294 N/A 1860299 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1860300 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9UHD9:p.Pro497His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066562. Q9UHD9:p.Pro497Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_06656 Q9UHD9:p.Pro506Thr mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066564. Q9UHD9:p.Pro509Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066565. Q9UHD9:p.Pro525Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066566. physical association physical association false false false 2A ubqln2-hnrnpa1-3 1860294 N/A 1860301 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1860300 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9UHD9:p.Pro497His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066562. Q9UHD9:p.Pro497Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_06656. Q9UHD9:p.Pro506Thr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066564. Q9UHD9:p.Pro509Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066565. Q9UHD9:p.Pro525Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066566. physical association physical association false false false 2A ubqln2-hnrnpu-3 1860294 N/A 1860302 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1860300 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9UHD9:p.Pro497His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066562. Q9UHD9:p.Pro497Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_06656. Q9UHD9:p.Pro506Thr mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066564 Q9UHD9:p.Pro509Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066565. Q9UHD9:p.Pro525Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066566. physical association physical association false false false 2c ubqln2-hnrnpu-2 1860295 N/A 1860302 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes N/A 1860300 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 3A and B ubqln1-hnrnpa1-2 1860295 N/A 1860303 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1860299 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false 3A and B ubqln2-hnrnpa1-5 1860295 N/A 1860304 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes N/A 1860300 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 3A and B ubqln2-hnrnpa1-4 1860296 N/A 1860300 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1860299 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P09651-2:p.Asp262Val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false HNRNPA1 disease variant found in inclusion body myopathy with early-onset Paget disease with or without frontotemporal dementia 3 (IBMPFD3; MIM:615424; UniProt FTId: VAR_070589. ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3C and D, 5B ubqln2-hnrnpa1-8 1860297 N/A 1860304 unspecified role unspecified role prey prey cell lysate cell lysate N/A 1860300 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9UHD9:p.Pro497His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066562. Q9UHD9:p.Pro497Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_06656. undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066564 undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066565 Q9UHD9:p.Pro525Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false UBQLN2 disease variant found in amyotrophic lateral sclerosis 15, with or without frontotemporal dementia (ALS15; MIM:300857); UniProt FTId: VAR_066566 physical association physical association false false false 4B, 4C and D, supplement. S2 and S4 ubqln2-hnrnpa1-7 1860298 N/A 1860299 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1860300 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4B