MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint moreno_beltr_n-2015-2 Respiratory complexes III and IV can each bind two molecules of cytochrome c at low ionic strength. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Moreno-Beltrán B., Díaz-Moreno I., González-Arzola K., Guerra-Castellano A., Velázquez-Campoy A., De la Rosa M.A., Díaz-Quintana A. idiazmoreno@us.es FEBS Lett. (0014-5793) 2015 Only protein-protein interactions imex curation moreno_beltr_n-2015-1 Respiratory complexes III and IV can each bind two molecules of cytochrome c at low ionic strength. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Moreno-Beltrán B., Díaz-Moreno I., González-Arzola K., Guerra-Castellano A., Velázquez-Campoy A., De la Rosa M.A., Díaz-Quintana A. idiazmoreno@us.es FEBS Lett. (0014-5793) 2015 Only protein-protein interactions imex curation moreno_beltr_n-2015-3 Respiratory complexes III and IV can each bind two molecules of cytochrome c at low ionic strength. in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Moreno-Beltrán B., Díaz-Moreno I., González-Arzola K., Guerra-Castellano A., Velázquez-Campoy A., De la Rosa M.A., Díaz-Quintana A. idiazmoreno@us.es FEBS Lett. (0014-5793) 2015 Only protein-protein interactions imex curation cyc_human Cytochrome c CYCS CYC protein protein human Homo sapiens Human MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE cyc1b_arath Cytochrome c1 2, heme protein, mitochondrial CYC1-2 Complex III subunit 4-2 Complex III subunit IV-2 Cytochrome b-c1 complex subunit 4-2 Ubiquinol-cytochrome c reductase complex cytochrome c1 subunit 2 MHK7.4 At5g40810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVGGGVIRQLLRRKLHSQSVATPVLSWLSSKKANEDAGSAGLRAFALMGAGITGLLSFSTVASADEAEHGLECPNYPWPHEGILSSYDHASIRRGHQVYQQVCASCHSMSLISYRDLVGVAYTEEEAKAMAAEIEVVDGPNDEGEMFTRPGKLSDRLPEPYSNESAARFANGGAYPPDLSLVTKARHNGQNYVFALLTGYRDPPAGISIREGLHYNPYFPGGAIAMPKMLNDEAVEYEDGTPATEAQMGKDVVSFLSWAAEPEMEERKLMGFKWIFLLSLALLQAAYYRRLKWSVLKSRKLVLDVVN cox1_bovin Cytochrome c oxidase subunit 1 MT-CO1 COI COXI Cytochrome c oxidase polypeptide I MTCO1 protein protein bovin Bos taurus (Bovine) Bovine MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK cyc12-cycs-1 1779756 n/a 1779759 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified n/a 1779760 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 1779756 t1 f3 sf5 ITC binding experiments corresponding to the reduced hCc–pCc1 complexes cycs-mt_co1 1779756 n/a 1779759 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified n/a 1779761 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 1779756 f4 cyc12-cycs 1779757 n/a 1779760 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified n/a 1779759 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f2 sf2 sf4 mt-co1 1779758 n/a 1779761 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false sf6