MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint frohnecke-2015-1 Protein-protein interaction studies provide evidence for electron transfer from ferredoxin to lipoic acid synthase in Toxoplasma gondii. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Frohnecke N., Klein S., Seeber F. seeberf@rki.de FEBS Lett. (0014-5793) 2015 Only protein-protein interactions imex curation frohnecke-2015-2 Protein-protein interaction studies provide evidence for electron transfer from ferredoxin to lipoic acid synthase in Toxoplasma gondii. ecoli Escherichia coli (strain K12) reverse two hybrid reverse two hybrid predetermined predetermined participant predetermined Frohnecke N., Klein S., Seeber F. seeberf@rki.de FEBS Lett. (0014-5793) 2015 Only protein-protein interactions imex curation q8mpf8_toxgo Ferredoxin fdx protein protein toxgo Toxoplasma gondii HEAAFLGPSASRPSSTVSASSAEATLPTLGRQPGASASSLVSSAPLPRPCLGAAQRTTSLWSHSATRLCSEGATLEAGWRKAEPRNVRLRSHSRLFHRIKLQTPDGETKELECAEDEYILDAAEAAGIELPYSCRGGSCSTCAGKLLVGSVDGSEQVYLDDAQQKKGYVLLCTAYPKEDCTILTHQEDQLHSEGGDE lipa_toxgo Lipoyl synthase, apicoplast lipA Lipoate synthase Lipoic acid synthase protein protein toxgo Toxoplasma gondii MAYFFDFPTDTWVEDASPGGPPKRAFGHGLAAGSSHFASPVSRRRLPTITALLLFSLLSASQSGALSVSQCSRRVSLGPLLSRVSSVSCTPSAAASALASSLYPTDSLSSVEGSVAPRPPPSSLAFVLRRVPPAAYSSSLSPSVLRFKHSLPRPLQGSLVCAPGILGGAAGSARFAGCCGSQGRSCGSGKNPELPLKGSKDEVIPRVGTSTAGPRPDWFHVPAPQAASRGAEESRYQQLQKQIRGLDLHTVCEEAKCPNIGECWNGGTATLILLGDTCTRGCRFCAIKTSSKPPPPDPLEPEKVADAVAKWDIDYVVMTSVDRDDMPDGGAGHFARTVQLVKKAKPSMLIECLVSDFQGMEESVRTLAQSGLDVYAHNIETVRRLTPYVRDKRAKYDQSLRVLHLAKQFNPSLFTKSSIMLGLGETSEEVVRTLRDLRDHDVDVVTLGQYLRPTKQQLGVVEYVTPETFKKYQDIAEEMGFKYVASGPLVRSSYKAGEYYMKHLIDDARKHGRRETVKQVKLEADVGTLKGTTTTFQVNEKEA fer_plaf7 Ferredoxin, apicoplast FD PF3D7_1318100 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MNIVILLLILTFSIKHSNTYKLKNTYIPINYMYHNNKNILRSQKSKLFLNFLSNNQLANSNKQTCFFKSNIKSSISNIDNYDYIRKRYINTSNKNKLFYNITLRTNDGEKKIECNEDEYILDASERQNVELPYSCRGGSCSTCAAKLVEGEVDNDDQSYLDEEQIKKKYILLCTCYPKSDCVIETHKEDELHDM mint fdx-lipa 1778728 n/a 1778730 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell n/a 1778731 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false f3 lipa-fdx 1778728 n/a 1778732 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell n/a 1778731 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false f3 lipa-fdx-1 1778729 n/a 1778730 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell n/a 1778731 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false f4