HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html mayola-2014-1 RecA protein plays a role in the chemotactic response and chemoreceptor clustering of Salmonella enterica. salty Salmonella typhimurium anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mayola A., Irazoki O., Martínez I.A., Petrov D., Menolascina F., Stocker R., Reyes-Darias J.A., Krell T., Barbé J., Campoy S. Susana.Campoy@uab.cat PLoS ONE 2014 imex curation Only protein-protein interactions imex curation mayola-2014-2 ecoli Escherichia coli (strain K12) transcription compl transcriptional complementation assay transcription compl predetermined predetermined participant predetermined Mayola A., Irazoki O., Martínez I.A., Petrov D., Menolascina F., Stocker R., Reyes-Darias J.A., Krell T., Barbé J., Campoy S. Susana.Campoy@uab.cat PLoS ONE 2014 imex curation Only protein-protein interactions imex curation chew_salty Chemotaxis protein CheW cheW STM1920 protein protein salty Salmonella typhimurium MTGMSNVSKLAGEPSGQEFLVFTLGNEEYGIDILKVQEIRGYDQVTRIANTPAFIKGVTNLRGVIVPIVDLRVKFCEGDVEYDDNTVVIVLNLGQRVVGIVVDGVSDVLSLTAEQIRPAPEFAVTLSTEYLTGLGALGERMLILVNIEKLLNSEEMALLDIAASHVA reca_salty Protein RecA recA Recombinase A STM2829 protein protein salty Salmonella typhimurium MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPVYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGDNVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYNGEKIGQGKANATTWLKENPATAKEIEKRVRELLLSNQNATPDFAVDDSEGVAETNEDF reca-chew-1 1787853 n/a 1787855 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1787856 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B chew-reca-1 1787853 n/a 1787856 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1787855 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B reca-chew-2 1787854 N/A 1787855 unspecified role unspecified role unspecified role unspecified role N/A 1787856 unspecified role unspecified role unspecified role unspecified role physical association physical association false false false 1A