UniProt UniProt http://www.uniprot.org leblanc-2014-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined LeBlanc PM., Doggett TA., Choi J., Hancock MA., Durocher Y., Frank F., Nagar B., Ferguson TA., Saleh M. AGER/sRAGE coordinates, tags and expression system according supplier. Coordinates for AGER/sRAGE truncated constructs are not specified and are given approximatively according UniProt domain annotaion. The expression system for HMGB1 A-box 1-67 is not specified in the publication. maya.saleh@mcgill.ca The Journal of biological chemistry 2014 IMEx imex curation Only protein-protein interactions rage_human Advanced glycosylation end product-specific receptor AGER RAGE Receptor for advanced glycosylation end products protein protein human Homo sapiens Human MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP hmgb1_human High mobility group protein B1 HMGB1 HMG1 High mobility group protein 1 protein protein human Homo sapiens Human MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE ager-hmgb1-1 1856701 N/A 1856702 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 1856703 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 1856709 1856707 direct interaction direct interaction false false false 4D AGER/sRAGE truncated 23-342: KD=30E-9 M AGER/sRAGE V-C1-C2 truncated 23-330..330: KD=50E-9 M AGER/sRAGE V-C1 truncated 23-224..224: KD=40E-9 M ager-hmgb1-3 1856701 N/A 1856703 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1856702 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 1856714 1856712 direct interaction direct interaction false false false 4D AGER/sRAGE truncated 23-342: KD=3E-6 M AGER/sRAGE V-C1-C2 truncated 23-330..330: KD=4E-6 M AGER/sRAGE V-C1 truncated 23-224..224: KD=3E-6 M ager-hmgb1-4 1856701 N/A 1856703 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1856702 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 1856720 1856718 direct interaction direct interaction false false false 4D AGER/sRAGE truncated 23-342: KD=3E-6 M AGER/sRAGE V-C1-C2 truncated 23-330..330: KD=4E-6 M AGER/sRAGE V-C1 truncated 23-224..224: KD=3E-6 M