HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html cooper-2010-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column anti tag western anti tag western blot anti tag western Cooper CA., Zhang K., Andres SN., Fang Y., Kaniuk NA., Hannemann M., Brumell JH., Foster LJ., Junop MS., Coombes BK. The identities of protein(s) originating from each peak were verified by western blot (Fig. 4D) and LC-MS/MS. coombes@mcmaster.ca PLoS pathogens 2010 imex curation Only protein-protein interactions imex curation cooper-2010-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Cooper CA., Zhang K., Andres SN., Fang Y., Kaniuk NA., Hannemann M., Brumell JH., Foster LJ., Junop MS., Coombes BK. coombes@mcmaster.ca PLoS pathogens 2010 imex curation Only protein-protein interactions imex curation cooper-2010-2 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Cooper CA., Zhang K., Andres SN., Fang Y., Kaniuk NA., Hannemann M., Brumell JH., Foster LJ., Junop MS., Coombes BK. coombes@mcmaster.ca PLoS pathogens 2010 imex curation Only protein-protein interactions imex curation cooper-2010-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cooper CA., Zhang K., Andres SN., Fang Y., Kaniuk NA., Hannemann M., Brumell JH., Foster LJ., Junop MS., Coombes BK. coombes@mcmaster.ca PLoS pathogens 2010 imex curation Only protein-protein interactions imex curation cooper-2010-5 in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Cooper CA., Zhang K., Andres SN., Fang Y., Kaniuk NA., Hannemann M., Brumell JH., Foster LJ., Junop MS., Coombes BK. SsaN activity was tested in a pyruvate kinase-lactate dehydrogenase coupled assay that monitors NADH oxidation coupled with ATP hydrolysis. coombes@mcmaster.ca PLoS pathogens 2010 imex curation Only protein-protein interactions imex curation a0a0h3ndf5_salts srcA G1W50_06675 G1W53_10530 G1W54_10915 G1W56_11420 G1W62_08285 G1W63_11225 G1W64_11240 G1W67_08280 G1W86_09825 G1W87_11920 G1W89_10715 G1W92_13060 G1X03_11105 G1X04_11555 G1X09_11565 G1X10_11480 G1X13_11560 G1X17_11570 G1X23_11465 G1X29_13130 G1X32_10620 G1X38_10925 G1X42_13060 G1X44_08030 G1X47_09930 G1X49_11120 G1X50_05310 G1X51_11565 G1X52_11245 G1X57_09855 G1X61_08290 G1X64_08035 G1X66_10925 G1X67_08035 G1X68_10010 G1X69_11835 G1X71_11570 G1X76_10595 G1X80_10595 G1X84_12190 G1X85_12455 G1X86_10025 G1X87_05310 G1X94_10450 G1X96_10030 G1X99_11255 G1Y02_10625 G1Y04_08025 G1Y11_11335 SL1344_2114 protein protein salts Salmonella typhimurium (strain SL1344) MYSRADRLLRQFSLKLNTDSIVFDENRLCSFIIDNRYRILLTSTNSEYIMIYGFCGKPPDNNNLAFEFLNANLWFAENNGPHLCYDNNSQSLLLALNFSLNESSVEKLECEIEVVIRSMENLYHILQDKGITLDTDYT a0a0h3nb84_salts Protein-secreting ATPase ssaN G1W50_10945 G1W53_02170 G1W54_02170 G1W56_05525 G1W62_10365 G1W63_02170 G1W64_07930 G1W67_10360 G1W86_01850 G1W87_09685 G1W89_04955 G1W92_07390 G1X03_02170 G1X04_01955 G1X09_05265 G1X10_02170 G1X13_05265 G1X17_05265 G1X23_02155 G1X29_05265 G1X32_04850 G1X38_02170 G1X42_07390 G1X44_10110 G1X47_04835 G1X49_02170 G1X50_07390 G1X51_05265 G1X52_07935 G1X57_16250 G1X61_10370 G1X64_10115 G1X66_02170 G1X67_10115 G1X68_02170 G1X69_05530 G1X71_05270 G1X76_02170 G1X80_02170 G1X84_04855 G1X85_02170 G1X86_07615 G1X87_07410 G1X94_04835 G1X96_07620 G1X99_07945 G1Y02_04855 G1Y04_10105 G1Y11_08275 SL1344_1349 protein protein salts Salmonella typhimurium (strain SL1344) MKNELMQRLRLKYPPPDGYCRWGRIQDVSATLLNAWLPGVFMGELCCIKPGEELAEVVGINGSKALLSPFTSTIGLHCGQQVMALRRRHQVPVGEALLGRVIDGFGRPLDGRELPDVCWKDYDAMPPPAMVRQPITQPLMTGIRAIDSVATCGEGQRVGIFSAPGVGKSTLLAMLCNAPDADSNVLVLIGERGREVREFIDFTLSEETRKRCVIVVATSDRPALERVRALFVATTIAEFFRDNGKRVVLLADSLTRYARAAREIALAAGETAVSGEYPPGVFSALPRLLERTGMGEKGSITAFYTVLVEGDDMNEPLADEVRSLLDGHIVLSRRLAERGHYPAIDVLATLSRVFPVVTSHEHRQLAAILRRCLALYQEVELLIRIGEYQRGVDTDTDKAIDTYPDICTFLRQSKDEVCGPELLIEKLHQILTE a0a0h3ndl6_salts sseL SL1344_2256 protein protein salts Salmonella typhimurium (strain SL1344) MSDEALTLLFSAVENGDQNCIDLLCNLALRNDDLGHRVEKFLFDLFSGKRTGSSDIDKKINQACLVLHQIANNDITKDNTEWKKLHAPSRLLYMAGSATTDLSKKIGIAHKIMGDQFAQTDQEQVGVENLWCGARMLSSDELAAATQGLVQESPLLSVNYPIGLIHPTTKENILSTQLLEKIAQSGLSHNEVFLVNTGDHWLLCLFYKLAEKIKCLIFNTYYDLNENTKQEIIEAAKIAGISESDEVNFIEMNLQNNVPNGCGLFCYHTIQLLSNAGQNDPATTLREFAENFLTLSVEEQALFNTQTRRQIYEYSLQ atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) srca-srca-1 1792829 N/A 1792834 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1792834 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 4D srca-ssan-1 1792829 N/A 1792834 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1792835 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 4D srca-srca-3 1792830 N/A 1792834 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 1792834 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 4A-C srca-ssan-2 1792830 N/A 1792834 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 1792835 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 4A-C srca-ssel-1 1792831 N/A 1792836 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 1792834 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 5B srca-srca-2 1792832 N/A 1792834 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 1792834 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false table 1 R work -0.214 R free -0.253 2.5 A ssan-2 1792833 N/A 1792837 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component N/A 1792835 ms participant Identification by mass spectrometry ms participant enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) atpase reaction atpase reaction false false false s1