HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html brown-2009-1 chick-df-1 df-1_chick embryonic fibroblasts Chicken df-1 Primary chicken embryonic fibroblasts DF-1 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Brown AC., Smith LP., Kgosana L., Baigent SJ., Nair V., Allday MJ. venu.gopal@bbsrc.ac.uk Journal of virology 2009 imex curation Only protein-protein interactions imex curation brown-2009-2 chick-df-1 df-1_chick embryonic fibroblasts Chicken df-1 Primary chicken embryonic fibroblasts DF-1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Brown AC., Smith LP., Kgosana L., Baigent SJ., Nair V., Allday MJ. venu.gopal@bbsrc.ac.uk Journal of virology 2009 imex curation Only protein-protein interactions imex curation q77q71_9alph R-LORF7 Meq meq MDV005 MDV076 protein protein Gallid herpesvirus 2 Gallid herpesvirus 2 MSQEPEPGAMPYSPADDPSPLDLSLGSTSRRKKRKSHDIPNSPSKHPFPDGLSEEEKQKLERRRKRNRDAARRRRRKQTDYVDKLHEACEELQRANEHLRKEIRDLRTECTSLRVQLACHEPVCPMAVPLTVTLGLLTTPHDPVPEPPICTPPPPSPDEPNAPHCSGSQPPICTPPPPDTEELCAQLCSTPPPPISTPHIIYAPGPSPLQPPICTPPPPDAEELCAQLCSTPPPPICTPHSLFCPPQPPSPEGIFPALCPVTEPCTPPSPGTVYAQLCPVGQAPLFTPSPPHPAPEPERLYARLTEDPEQDSLYSGQIYIQFPSDTQSTVWWFPGDGRP jun_chick Transcription factor AP-1 Proto-oncogene c-Jun JUN protein protein chick Gallus gallus (Chicken) Chicken MSAKMEPTFYEDALNASFAPPESGGYGYNNAKVLKQSMTLNLSDAASSLKPHLRNKNADILTSPDVGLLKLASPELERLIIQSSNGLITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHNQNTLPSVTSAAQPVSGGMAPVSSMAGGGSFNTSLHSEPPVYANLSNFNPNALNSAPNYNANGMGYAPQHHINPQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF meq-meq-1 1851955 N/A 1851957 unspecified role unspecified role bait bait Q77Q71:p.[Leu92Ala;Leu99Ala;Leu106Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q77Q71:p.[Ala88Glu;Cys89Thr;Gln93Glu;Ala95Glu;Asn96Lys;Arg100Gln;Arg107Glu;Cys110Lys;Arg114Glu] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1851957 unspecified role unspecified role prey prey Q77Q71:p.[Leu92Ala;Leu99Ala;Leu106Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q77Q71:p.[Ala88Glu;Cys89Thr;Gln93Glu;Ala95Glu;Asn96Lys;Arg100Gln;Arg107Glu;Cys110Lys;Arg114Glu] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 3A meq-jun-1 1851956 N/A 1851958 unspecified role unspecified role prey prey N/A 1851957 unspecified role unspecified role bait bait Q77Q71:p.[Leu92Ala;Leu99Ala;Leu106Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3B