DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ brown-2006-1 chick-msb-1 chick lymphoblastoid cell line Chicken msb-1 chicken lymphoblastoid cell line MSB-1 confocal microscopy confocal microscopy immunostaining immunostaining Brown AC., Baigent SJ., Smith LP., Chattoo JP., Petherbridge LJ., Hawes P., Allday MJ., Nair V. m.allday@imperial.ac.uk Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation For the MEQ protein UniProt accession number Q9DGW5 has been used, taken from the reference proteome, as no Meq entry is available for strains used in this publication. Only protein-protein interactions brown-2006-2 in vitro In vitro pull down pull down autoradiography autoradiography Brown AC., Baigent SJ., Smith LP., Chattoo JP., Petherbridge LJ., Hawes P., Allday MJ., Nair V. m.allday@imperial.ac.uk Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation For the MEQ protein UniProt accession number Q9DGW5 has been used, taken from the reference proteome, as no Meq entry is available for strains used in this publication. Only protein-protein interactions brown-2006-3 chick-df-1 df-1_chick embryonic fibroblasts Chicken df-1 Primary chicken embryonic fibroblasts DF-1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Brown AC., Baigent SJ., Smith LP., Chattoo JP., Petherbridge LJ., Hawes P., Allday MJ., Nair V. m.allday@imperial.ac.uk Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation For the MEQ protein UniProt accession number Q9DGW5 has been used, taken from the reference proteome, as no Meq entry is available for strains used in this publication. Only protein-protein interactions meq_gahvm Oncoprotein MEQ MDV005 MDV076 protein protein gahvm Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GaHV-2 Marek's disease herpesvirus type 1 MSQEPEPGAMPYSPADDPSPLDLSLGSTSRRKKRKSHDIPNSPSKHPFPDGLSEEEKQKLERRRKRNRDAARRRRRKQTDYVDKLHEACEELQRANEHLRKEIRDLRTECTSLRVQLACHEPVCPMAVPLTVTLGLLTTPHDPVPEPPICTPPPPSPDEPNAPHCSGSQPPICTPPPPDTEELCAQLCSTPPPPISTPHIIYAPGPSPLQPPICTPAPPDAEELCAQLCSTPPPPICTPHSLFCPPQPPSPEGIFPALCPVTEPCTPPSPGTVYAQLCPVGQVPLFTPSPPHPAPEPERLYARLTEDPEQDSLYSGQIYTQFPSDTQSTVWWFPGDGRP q5ziz6_chick RCJMB04_22g9 protein protein chick Gallus gallus (Chicken) Chicken MQGIRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTMCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVIFYDPYLSDGMERALGLQRVSTLQDLLFHSDCVTLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAATHWASMDPGVVHPELNGAAYSRYPPGVVSVAPTGIPTAVEGIVPNPMSLSHGLPAVAHPPHAPSPGQTVKPEADRDHPSDQL meq-ctbp-1 1851972 N/A 1851975 unspecified role unspecified role neutral component neutral component N/A 1851976 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1D ctbp1-r_lorf7-1 1851973 N/A 1851975 unspecified role unspecified role bait bait Q9DGW5:p.[Pro20_Ser24delinsAlaValGluPheThr;Pro49_Ser53delinsProAspAlaMetAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 1851976 unspecified role unspecified role prey prey N/A 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2B r_lorf7-ctbp1-1 1851974 N/A 1851975 unspecified role unspecified role prey prey Q9DGW5:p.Pro20_Ser24delinsAlaValGluPheThr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false N/A 1851976 unspecified role unspecified role bait bait physical association physical association false false false 2C