UniProt UniProt http://www.uniprot.org leimkuhler-2003-1 Mechanistic studies of human molybdopterin synthase reaction and characterization of mutants identified in group B patients of molybdenum cofactor deficiency. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Leimkuhler S., Freuer A., Araujo J.A., Rajagopalan K.V., Mendel R.R. s.leimkuehler@tu-bs.de J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation moc2a_human Molybdopterin synthase sulfur carrier subunit MOCS2 MOCO1 MOCO1-A Molybdenum cofactor synthesis protein 2 small subunit Molybdenum cofactor synthesis protein 2A Molybdopterin-synthase small subunit Sulfur carrier protein MOCS2A protein protein human Homo sapiens Human MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISGG moc2b_human Molybdopterin synthase catalytic subunit Molybdenum cofactor synthesis protein 2 large subunit Molybdopterin-synthase large subunit Molybdenum cofactor synthesis protein 2B MOCO1-B MOCS2 MCBPE MOCO1 protein protein human Homo sapiens Human MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS mocs2-mocs2-2 1775527 n/a 1775528 unspecified role unspecified role neutral component neutral component purified purified O96033:p.Val7Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Variant found in Molybdenum cofactor deficiency, complementation group B (MOCODB) [MIM:252160]; UniProt FTId: VAR_054854 ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1775529 unspecified role unspecified role neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false 2, 6A Whereas the the MOCS2A-V7F variant did not form a complex with MOCS2B; the MPT synthase tetramer was readily formed in mixtures of MOCS2B-E168K and equimolar amounts of MOCS2A. mocs2-mocs2-3 1775527 n/a 1775528 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false 2 Elution position is suggesting homodimer formation in solution mocs2-mocs2-4 1775527 n/a 1775529 unspecified role unspecified role neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false 2 Elution position is suggesting homodimer formation in solution