IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mason-2000-5 yeast Saccharomyces cerevisiae Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mason N., Ciufo LF., Brown JD., Mason N., Ciufo LF., Brown JD. Jeremy.Brown@ncl.ac.uk The EMBO journal 2000 imex curation Only protein-protein interactions mason-2000-6 yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Mason N., Ciufo LF., Brown JD., Mason N., Ciufo LF., Brown JD. Jeremy.Brown@ncl.ac.uk The EMBO journal 2000 imex curation Only protein-protein interactions mason-2000-4 yeast Saccharomyces cerevisiae Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom weight by staining molecular weight estimation by staining weight by staining Mason N., Ciufo LF., Brown JD., Mason N., Ciufo LF., Brown JD. Author states that protein identifications were confirmed by western blot Jeremy.Brown@ncl.ac.uk The EMBO journal 2000 imex curation Only protein-protein interactions mason-2000-7 yeast Saccharomyces cerevisiae Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Mason N., Ciufo LF., Brown JD., Mason N., Ciufo LF., Brown JD. Jeremy.Brown@ncl.ac.uk The EMBO journal 2000 imex curation Only protein-protein interactions srp14_yeast Signal recognition particle subunit SRP14 SRP14 YDL092W D2404 Signal recognition particle 14 kDa protein homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MANTGCLSPGAFLSKVPEFFQTANEKHITVRLTAKRLIEHDPVEGNLEFDSTNHPDYDVSKKASEISVSSRSDREYPLLIRMSYGSHDKKTKCSTVVKASELDQFWQEYSSVFKGGMQNLIKKKKKKSKNGTISKTGKKNKVAKKN sec65_yeast Signal recognition particle subunit SEC65 YM8339.14C YML105C SEC65 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPRLEEIDDFNDIDDLDMELAELDPSLRTPIAPKITPKVVRSQDQENPAFLPGTNNNSNSNNNSSNEKEQLSFINPKTGKVERSEAISKKDLEEVKRFQVLYPCYFDINRSHKEGRRVPKELAVENPLAKTMADAVRELGILCIFEGEKCHPQDFGNPGRIRVLFKENGQLIGAATKFKGGKRQLMKAVGEYMKRHPTTIESLREIPYGPDFDNIEFKKIPRVKGFKMNEIVPLHSPFLMGHPMTKSVYETPKITAAEKSFKPPKNKYKVVRR srp72_yeast Signal recognition particle subunit SRP72 YPL210C SRP72 Signal recognition particle 72 kDa protein homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MAKDNLTNLLSQLNIQLSQDEHSQVEQTCVKLLDSGCENPADVFRRCLVAVIQQDKYQKALHYLKKFKHIDDKYGRKFALEKLYIFYKLNMPDEFNTLYTAIITDDLDTVLKKDIESLRGILHVRAQYCYKNGLYQEAFKIYQHLASHNEKDQDSQIELSCNERVPLSVATELMNRSPLVTPMDESSYDLLFNESFIMASVGKYDKAIELLEKALQGATNEGYQNDINTIKLQLSFVLQMVGKTAQSKEILKGLLQELKADSPFSLICQNNLNAFVDFSKYNTNFNLLLRELNVEKLNTFNLQTFTHEQWSNIQRNVLFLRLFNNVKIHSQESLLSRTFDKYSKLVDNVTLESYKTQAKKLYHHTTKTILSGTDGSTIGILLLTIQLLIIEKEWENAIRIGELFLNESWKSSFEKFNDSQAIVCYILFELYKIKGRNNSKSVLLKKLGSVRVQLSGKIQENIPFWKHVGFELLSMGNAKESKALLREISNFSKGDADVLVDRVVSSDSLDIAQGIDLVRDIDIDKLIQLGVKPLESSAKRSKNTAVSKVQKRKVLELKKKRKIKRLEKFLQGRDTSKLPDPERWLPLRDRSTYRPKKKQQGAKQTQGGAMNKKSEQALDISKKGKPTVNKKPKNKKKGRK srp21_yeast Signal recognition particle subunit SRP21 SRP21 YKL122C YKL527 Signal recognition particle 21 kDa protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVKPIDNYITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNSHLSLNYKFTTNKSKDVSRLLSALGPRGVSITPGKIEKIAQSKKKNNKIKESSKKIKGKSIQDIVGLATLIVNTDVEKSDPAAKKTATEPKQKANAVQNNNGNSAASKKKKNKNKGKKKR scr1 yeast Signal Recognition Particle RNA yeast srprna signal recognition particle rna srpRNA srprna yeast Saccharomyces cerevisiae Baker's yeast AGGCUGUAAUGGCUUUCUGGUGGGAUGGGAUACGUUGAGAAUUCUGGCCGAGGAACAAAUCCUUCCUCGCGGCUAGACACGGAUUGCACGCCCUUUGGGCAAGGGAUAGUUCUCUAUUCCGCACCGUGCCCUGUUGUGGCAACCGUCUUUCCUCCGUCGUAAAUUUGUCCUGGGCAGAGCUGUCUGCCCGGAGGCGGGAGAGUCCGUUCUGAAGUGUCCCGGCUAUAAUAAAUCGAUCUUUGCGGGCAGCCCGUUGGCAGGAGGCGUGAGGAAUCCGUCUCUCUGUCUGGUGCGGCAAGGUAGUUCUGGGUCCUUAGGGGCUCCACCUUCACCGCUGUUAGGGGAGUUUUAUCCAGCGUCAGCAAAGGUGACCCGUGAUGGAGGCGGCCGGGAUAGCACAUAUCAGUCGGAUAAUUGUGCAAGUUGAUCGCUUCGGCGGUUUAAUUUGGCGGUGCCAUCAGGAUUUACUCGCACAUUGUGGCCGUUCCCUCGGGGAUGGAGUGUGUCCUGAACCAUAUUUUU srp54_yeast Signal recognition particle subunit SRP54 SRH1 P9513.14 YPR088C SRP54 Signal recognition particle 54 kDa protein homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MVLADLGKRINSAVNNAISNTQDDFTTSVDVMLKGIVTALLESDVNIALVSKLRNNIRSQLLSENRSEKSTTNAQTKKLIQKTVFDELCKLVTCEGSEEKAFVPKKRKTNIIMFVGLQGSGKTTSCTKLAVYYSKRGFKVGLVCADTFRAGAFDQLKQNAIRARIPFYGSYTETDPAKVAEEGINKFKKEKFDIIIVDTSGRHHQEEELFQEMIEISNVIKPNQTIMVLDASIGQAAEQQSKAFKESSDFGAIILTKMDGHARGGGAISAVAATNTPIIFIGTGEHIHDLEKFSPKSFISKLLGIGDIESLFEQLQTVSNKEDAKATMENIQKGKFTLLDFKKQMQTIMKMGPLSNIAQMIPGMSNMMNQVGEEETSQKMKKMVYVLDSMTKEELESDGRMFIEEPTRMVRVAKGSGTSVFEVEMILMQQQMMARMAQTATQQQPGAPGANARMPGMPNMPGMPNMPGMPNMPGMPKVTPQMMQQAQQKLKQNPGLMQNMMNMFGGGMGGGMGGGMPDMNEMMKMMQDPQMQQMAKQFGMG 05B1B2C262932F17 srp68_yeast Signal recognition particle subunit SRP68 YPL243W SRP68 Signal recognition particle 68 kDa protein homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAYSPIIATYGNRAEQFLETDSDFAKYHAKLNKKLQHLRSRCHLVTKDTKKYSSKNKYGEINSEDYDNKTKLIGVLILLHAERDLALAETLKLRARQRGKLKKSEEKVLSTRLKKACKTADKLVNVTQNEQQWITRAQYLAFAKLVHSEYLINGKRFKRKDNAKISNNLALVFAALEHLKNLSLLAEEVVDNIVNKYQYSLKQYAGNLITTPEINNFIVERVQSDENKDDELVKLLLDNGFNMKKITTSTEDQKVTTNINWRSFNAKIIDAEVAQFLEQGLSIHPTQITQYTQRLSKLEKALDRHEFFIANHDDQDDIDEMVENSSENNQIILAYIKYNILLTSISRERDLFTHLWNQWLKLNTSLPSKLTKYKEMERIVKNLTKYLSDIMELPGVYSDDELLSQLDLCKLYFQLFLNTGCLSVLYQSKGRYMEALALYVDAYRRLENKLSEIESLDEILLPANLLSLNSVRSLQKRIENGGNSVITLAEYEKRNHGGSLGKYDLTVIEKLDSKKILPTDIQLKNLFPLKPKMLPIPSKPTLFDLAFNYITYDKQEPSASQVKDSVTETESISQTPISNEQTEGEPKKKRGFLGLFGR sec65-srp14-4 1876012 N/A 1876016 unspecified role unspecified role prey prey N/A 1876016 unspecified role unspecified role prey prey tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false the tagged and untagged srp14 proteins were both present in the complex N/A 1876017 unspecified role unspecified role bait bait association association false false false Fig4A sec65-srp72-1 1876012 N/A 1876018 unspecified role unspecified role prey prey N/A 1876018 unspecified role unspecified role prey prey tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1876017 unspecified role unspecified role bait bait association association false false false Fig4B both tagged and untagged srp72 proteins can bind to sec65 sec65-srp21-2 1876012 N/A 1876019 unspecified role unspecified role prey prey tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1876017 unspecified role unspecified role bait bait N/A 1876019 unspecified role unspecified role prey prey tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false HA tag and Myc tag are mutually exclusive association association false false false Fig4C sec65-srp14-5 1876013 N/A 1876017 unspecified role unspecified role prey prey N/A 1876016 unspecified role unspecified role bait bait tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false untagged srp14 was also present in the complex Stoichiometry: 2.0 physical association physical association false false false Fig4A sec65-srp21-1 1876013 N/A 1876019 unspecified role unspecified role bait bait tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1876017 unspecified role unspecified role prey prey physical association physical association false false false Fig4C scr1_srp-1 1876014 N/A 1876020 northern blot northern blot northen unspecified role unspecified role prey prey N/A 1876017 unspecified role unspecified role prey prey N/A 1876019 unspecified role unspecified role prey prey N/A 1876016 unspecified role unspecified role prey prey N/A 1876021 unspecified role unspecified role prey prey N/A 1876022 unspecified role unspecified role prey prey N/A 1876018 unspecified role unspecified role bait bait tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false Fig1 sec65-srp72-2 1876015 N/A 1876017 unspecified role unspecified role prey prey N/A 1876018 unspecified role unspecified role bait bait tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig4B