MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014i-1 Ultra-high resolution crystal structure of recombinant caprine β-lactoglobulin in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined renwick.dobson@canterbury.ac.nz 2014 imex curation Crowther J.M., Lassé M., Suzuki H., Kessans S.A., Loo T.S., Norris G.E., Hodgkinson A.J., Jameson G.B., Dobson R.C. FEBS Lett. (0014-5793) Only protein-protein interactions anonymous-2014za-2 Ultra-high resolution crystal structure of recombinant caprine β-lactoglobulin in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined renwick.dobson@canterbury.ac.nz 2014 imex curation Crowther J.M., Lassé M., Suzuki H., Kessans S.A., Loo T.S., Norris G.E., Hodgkinson A.J., Jameson G.B., Dobson R.C. FEBS Lett. (0014-5793) Only protein-protein interactions anonymous-2014za-3 Ultra-high resolution crystal structure of recombinant caprine β-lactoglobulin in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined renwick.dobson@canterbury.ac.nz 2014 imex curation Crowther J.M., Lassé M., Suzuki H., Kessans S.A., Loo T.S., Norris G.E., Hodgkinson A.J., Jameson G.B., Dobson R.C. FEBS Lett. (0014-5793) Only protein-protein interactions lacb_caphi Beta-lactoglobulin LGB protein protein goat Capra hircus Goat MKCLLLALGLALACGIQAIIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGNLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDKEALEKFDKALKALPMHIRLAFNPTQLEGQCHV lacb_bovin Beta-lactoglobulin LGB protein protein bovin Bos taurus (Bovine) Bovine MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI lgb 1566599 n/a cBlg 1566602 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false f2b f2c lgb-1 1566599 n/a bBlg 1566603 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false f2b f2c lgb-1 1566600 n/a cBlg 1566602 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false f3 t1 lgb-1 1566601 n/a cBlg 1566602 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false f4 t2