IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ schrick-2014-1 Shared functions of plant and mammalian StAR-related lipid transfer (START) domains in modulating transcription factor activity. yeast Saccharomyces cerevisiae Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom ms participant Identification by mass spectrometry ms participant Schrick K., Bruno M., Khosla A., Cox P.N., Marlatt S.A., Roque R.A., Nguyen H.C., He C., Snyder M.P., Singh D., Yadav G. Only high confidence and standard matched protein-metabolite interactions have been included in this data set. mbruno@stanford.edu BMC Biol. 2014 star_mouse Steroidogenic acute regulatory protein, mitochondrial Star Luteinizing hormone-induced protein START domain-containing protein 1 protein protein mouse Mus musculus Mouse MFLATFKLCAGSSYRHMRNMKGLRHQAVLAIGQELNWRALGDSSPGWMGQVRRRSSLLGSQLEATLYSDQELSYIQQGEVAMQKALGILNNQEGWKKESQQENGDEVLSKMVPDVGKVFRLEVVVDQPMDRLYEELVDRMEAMGEWNPNVKEIKVLQRIGKDTVITHELAAAAAGNLVGPRDFVSVRCTKRRGSTCVLAGMATHFGEMPEQSGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKTIINQVLSQTQIEFANHLRKRLEASPASEAQC vitamin e vitamin E vitamin E small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) taurocholic acid taurocholic acid 3alpha,7alpha,12alpha-trihydroxy-5beta-cholanic acid 24-taurine cholic acid taurine conjugate Choloyl-taurine Cholyltaurine N-choloyltaurine Taurocholate Taurocholic acid 2-[(3alpha,7alpha,12alpha-trihydroxy-24-oxo-5beta-cholan-24-yl)amino]ethanesulfonic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) WBWWGRHZICKQGZ-HZAMXZRMSA-N squalene squalene (all-E)-2,6,10,15,19,23-hexamethyl-2,6,10,14,18,22-tetracosahexaene Spinacene Squalene squalene Supraene (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) YYGNTYWPHWGJRM-AAJYLUCBSA-N lanosterol lanosterol (3beta)-lanosta-8,24-dien-3-ol (3beta,5alpha)-4,4,14-trimethylcholesta-8,24-dien-3-ol 4,4',14alpha-Trimethyl-5alpha-cholesta-8,24-dien-3beta-ol Lanosterin Lanosterol LANOSTEROL lanosterol lanosta-8,24-dien-3beta-ol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) CAHGCLMLTWQZNJ-BQNIITSRSA-N ppct_human Phosphatidylcholine transfer protein StAR-related lipid transfer protein 2 PCTP STARD2 START domain-containing protein 2 protein protein human Homo sapiens Human MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT alpha-tocotrienol alpha-tocotrienol alpha-tocotrienol alpha-tocotrienol zeta1-tocopherol (2R)-2,5,7,8-tetramethyl-2-[(3E,7E)-4,8,12-trimethyltrideca-3,7,11-trien-1-yl]-3,4-dihydro-2H-chromen-6-ol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) RZFHLOLGZPDCHJ-XZXLULOTSA-N hgl2_arath Homeobox-leucine zipper protein GLABRA 2 GL2 ATHB10 HD-ZIP protein ATHB-10 Homeobox-leucine zipper protein ATHB-10 F19K16.20 At1g79840 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSMAVDMSSKQPTKDFFSSPALSLSLAGIFRNASSGSTNPEEDFLGRRVVDDEDRTVEMSSENSGPTRSRSEEDLEGEDHDDEEEEEEDGAAGNKGTNKRKRKKYHRHTTDQIRHMEALFKETPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHENSLLKAELEKLREENKAMRESFSKANSSCPNCGGGPDDLHLENSKLKAELDKLRAALGRTPYPLQASCSDDQEHRLGSLDFYTGVFALEKSRIAEISNRATLELQKMATSGEPMWLRSVETGREILNYDEYLKEFPQAQASSFPGRKTIEASRDAGIVFMDAHKLAQSFMDVGQWKETFACLISKAATVDVIRQGEGPSRIDGAIQLMFGEMQLLTPVVPTREVYFVRSCRQLSPEKWAIVDVSVSVEDSNTEKEASLLKCRKLPSGCIIEDTSNGHSKVTWVEHLDVSASTVQPLFRSLVNTGLAFGARHWVATLQLHCERLVFFMATNVPTKDSLGVTTLAGRKSVLKMAQRMTQSFYRAIAASSYHQWTKITTKTGQDMRVSSRKNLHDPGEPTGVIVCASSSLWLPVSPALLFDFFRDEARRHEWDALSNGAHVQSIANLSKGQDRGNSVAIQTVKSREKSIWVLQDSSTNSYESVVVYAPVDINTTQLVLAGHDPSNIQILPSGFSIIPDGVESRPLVITSTQDDRNSQGGSLLTLALQTLINPSPAAKLNMESVESVTNLVSVTLHNIKRSLQIEDC star-vitamin_e 1564505 n/a 1564506 unspecified role unspecified role bait bait c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind range range range range false c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1564507 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5D star-taurocholic_acid 1564505 n/a 1564506 unspecified role unspecified role bait bait c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind range range range range false n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1564508 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5D star-squalene 1564505 n/a 1564506 unspecified role unspecified role bait bait c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind range range range range false c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1564509 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5D star-lanosterol 1564505 n/a 1564510 unspecified role unspecified role prey prey n/a 1564506 unspecified role unspecified role bait bait c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind range range range range false n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5D ppct-taurocholic_acid 1564505 n/a 1564508 unspecified role unspecified role prey prey n/a 1564511 unspecified role unspecified role bait bait c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false Fig. 5D ppct-squalene 1564505 n/a 1564509 unspecified role unspecified role prey prey n/a 1564511 unspecified role unspecified role bait bait c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false Fig. 5D ppct-lanosterol 1564505 n/a 1564511 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1564510 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5D gl2-alpha_tocotrienol 1564505 n/a 1564512 unspecified role unspecified role prey prey n/a 1564513 unspecified role unspecified role bait bait start domain sufficient to bind sufficient binding region sufficient to bind range range range range false n-terminal gal4 dna bd gal4 dna binding domain gal4 dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal vp16 ad vp16 activation domain vp16 ad c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal zz tag zz tag ZZ tag ZZ tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false