MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014k-2 Rubisco Accumulation Factor 1 from Thermosynechococcus elongatus participates in the final stages of ribulose-1,5-bisphosphate carboxylase/oxygenase assembly in Escherichia coli cells and in vitro in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot piotr.kolesinski@ibmb.uni.wroc.pl 2014 imex curation Kolesinski P., Belusiak I., Czarnocki-Cieciura M., Szczepaniak A. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014h-3 Rubisco Accumulation Factor 1 from Thermosynechococcus elongatus participates in the final stages of ribulose-1,5-bisphosphate carboxylase/oxygenase assembly in Escherichia coli cells and in vitro in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined piotr.kolesinski@ibmb.uni.wroc.pl 2014 imex curation Kolesinski P., Belusiak I., Czarnocki-Cieciura M., Szczepaniak A. FEBS J. (1742-464X) Only protein-protein interactions raf1_theeb RuBisCO accumulation factor 1 raf1 tlr1766 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MSQDQDALTTEVLQRLRRKEGTWQDWGAGCRQLQKQGLSPQAIFEATGIEPIHQNQLITALQVSQSLGEAPESVRAYFQTRGSDLLYELRVLSAGDRLAAATLIVEKQLDVTAVHEVCRALKAVSYRKDNSEGFGESVGDRIGRYYWQLARQQRDLAQRSRLIAQGLRFVESASGRQALEKLLTDFTVVPAVNQPRLPLYRLDTAEEVPYLVPVAGTAPLTATVLQQVPRLSCTEVFRVVAVPQGMSLVALPAWQVLLNAVDPVAILWPAADLPAELPPSPEGLPIAQVLLVVDRGLAEWDRDRYLLIAPSPSEAVQLAWLPEPPTATVVGQLLLVLRPPQVLDESLNRELWFFEE rbl_theeb Ribulose bisphosphate carboxylase large chain cbbL rbcL tll1506 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MAYTQSKSQKVGYQAGVKDYRLTYYTPDYTPKDTDILAAFRVTPQPGVPFEEAAAAVAAESSTGTWTTVWTDLLTDLDRYKGCCYDIEPLPGEDNQFIAYIAYPLDLFEEGSVTNMLTSIVGNVFGFKALKALRLEDLRIPVAYLKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFLFVADAIHKAQAETGEIKGHYLNVTAPTCEEMLKRAEFAKELEMPIIMHDFLTAGFTANTTLSKWCRDNGMLLHIHRAMHAVMDRQKNHGIHFRVLAKCLRMSGGDHIHTGTVVGKLEGDKAVTLGFVDLLRENYIEQDRSRGIYFTQDWASMPGVMAVASGGIHVWHMPALVDIFGDDAVLQFGGGTLGHPWGNAPGATANRVALEACIQARNEGRDLMREGGDIIREAARWSPELAAACELWKEIKFEFEAQDTI cbbl-q8di26 1555503 n/a RAF1 1555505 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified tag strep tag strep tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a RbcL 1555506 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f2c cbbl-q8di26-1 1555504 n/a RbcL 1555506 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified n/a RAF1 1555505 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f4