MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014m-1 Modulation of CD6 function through interaction with Galectin-1 and -3 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa tag visualisation tag visualisation flozano@clinic.ub.es 2014 imex curation Escoda-Ferran C., Carrasco E., Caballero-Baños M., Miró-Julià C., Martínez-Florensa M., Consuegra-Fernández M., Martínez V.G., Liu F.T., Lozano F. FEBS Lett. (0014-5793) Only protein-protein interactions anonymous-2014y-2 Modulation of CD6 function through interaction with Galectin-1 and -3 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot flozano@clinic.ub.es 2014 imex curation Escoda-Ferran C., Carrasco E., Caballero-Baños M., Miró-Julià C., Martínez-Florensa M., Consuegra-Fernández M., Martínez V.G., Liu F.T., Lozano F. FEBS Lett. (0014-5793) Only protein-protein interactions anonymous-2014x-4 Modulation of CD6 function through interaction with Galectin-1 and -3 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection flozano@clinic.ub.es 2014 imex curation Escoda-Ferran C., Carrasco E., Caballero-Baños M., Miró-Julià C., Martínez-Florensa M., Consuegra-Fernández M., Martínez V.G., Liu F.T., Lozano F. FEBS Lett. (0014-5793) Only protein-protein interactions anonymous-2014y-3 Modulation of CD6 function through interaction with Galectin-1 and -3 in vitro In vitro competition binding competition binding tag visualisation tag visualisation flozano@clinic.ub.es 2014 imex curation Escoda-Ferran C., Carrasco E., Caballero-Baños M., Miró-Julià C., Martínez-Florensa M., Consuegra-Fernández M., Martínez V.G., Liu F.T., Lozano F. FEBS Lett. (0014-5793) Only protein-protein interactions cd6_human T-cell differentiation antigen CD6 CD6 T12 TP120 protein protein human Homo sapiens Human MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDCPGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAKVLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELMLLIPSIVLGILLLGSLIFIAFILLRIKGKYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTANPGHCITDPPSLGPQYHPRSNSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPPNLELAGTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDNDDYDDISAA leg1_human Galectin-1 Lectin galactoside-binding soluble 1 Beta-galactoside-binding lectin L-14-I S-Lac lectin 1 Galaptin 14 kDa lectin HPL HBL Putative MAPK-activating protein PM12 LGALS1 Lactose-binding lectin 1 14 kDa laminin-binding protein protein protein human Homo sapiens Human MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD leg3_human Galectin-3 LGALS3 MAC2 Galactose-specific lectin 3 Mac-2 antigen IgE-binding protein 35 kDa lectin Carbohydrate-binding protein 35 Laminin-binding protein Lectin L-29 L-31 Galactoside-binding protein protein protein human Homo sapiens Human MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI cd166_human CD166 antigen Activated leukocyte cell adhesion molecule ALCAM MEMD protein protein human Homo sapiens Human MESKGASSCRLLFCLLISATVFRPGLGWYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEKPDGSPVFIAFRSSTKKSVQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDNVFEAPTIVKVFKQPSKPEIVSKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLHPLEGAVVIIFKKEMDPVTQLYTMTSTLEYKTTKADIQMPFTCSVTYYGPSGQKTIHSEQAVFDIYYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKMTKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTCTAENQLERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAALVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA cd6-lgals1 1539675 n/a CD6 1539679 tag visualisation tag visualisation unspecified role unspecified role prey prey purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a Gal-1 1539680 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1b lgals1-cd6 1539675 n/a Gal-3 1539681 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P17931:p.Arg186Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a CD6 1539679 tag visualisation tag visualisation unspecified role unspecified role prey prey purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1c f1g alcam-lgals1 1539675 n/a Gal1 1539680 tag visualisation tag visualisation unspecified role unspecified role prey prey purified purified biotin/gst tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a ALCAM 1539682 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3a alcam-lgals1-1 1539675 n/a ALCAM 1539682 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a Gal3 1539681 tag visualisation tag visualisation unspecified role unspecified role prey prey purified purified biotin/gst tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3a lgals1-cd6-1 1539676 n/a CD6 1539679 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a Gal-1 1539680 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1e lgals3-cd6 1539676 n/a Gal-3 1539681 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a CD6 1539679 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1f alcam-lgals1-2 1539676 n/a ALCAM 1539682 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a Gal1 1539680 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3b lgals1-alcam 1539676 n/a Gal3 1539681 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a ALCAM 1539682 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3c alcam-cd6 1539677 n/a CD6 1539679 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified n/a ALCAM 1539682 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey purified purified tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3d cd6-alcam 1539677 n/a Gal3 1539681 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified P17931:p.Arg186Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a ALCAM 1539682 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey purified purified tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3d cd6-lgals1-1 1539678 n/a ALCAM 1539682 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a CD6 1539679 tag visualisation tag visualisation unspecified role unspecified role prey prey purified purified bioting tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a Gal1 1539680 predetermined predetermined participant predetermined competitor competitor competitor prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2d