MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014d-4 PEX14 binding to Arabidopsis PEX5 has differential effects on PTS1 and PTS2 cargo occupancy of the receptor in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot a.baker@leeds.ac.uk 2014 imex curation Lanyon-Hogg T., Hooper J., Gunn S., Warriner S.L., Baker A. FEBS Lett. (0014-5793) Only protein-protein interactions anonymous-2014i-1 PEX14 binding to Arabidopsis PEX5 has differential effects on PTS1 and PTS2 cargo occupancy of the receptor in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western a.baker@leeds.ac.uk 2014 imex curation Lanyon-Hogg T., Hooper J., Gunn S., Warriner S.L., Baker A. FEBS Lett. (0014-5793) Only protein-protein interactions anonymous-2014h-2 PEX14 binding to Arabidopsis PEX5 has differential effects on PTS1 and PTS2 cargo occupancy of the receptor in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay tag enzyme assay tag visualisation by enzyme assay tag enzyme assay a.baker@leeds.ac.uk 2014 imex curation Lanyon-Hogg T., Hooper J., Gunn S., Warriner S.L., Baker A. FEBS Lett. (0014-5793) Only protein-protein interactions pex7_arath Peroxisome biogenesis protein 7 Peroxin-7 Peroxisomal targeting signal type 2 receptor Pex7p F28N24.6 At1g29260 PEX7 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPVFKAPFNGYSVKFSPFYESRLAVATAQNFGILGNGRIHVLELAPGAPGVTESVSYDTADAVYDVCWSESHDSVLIAAIGDGSVKIYDTALPPPSNPIRSFQEHAREVQSVDYNPTRRDSFLTSSWDDTVKLWAMDRPASVRTFKEHAYCVYQAVWNPKHGDVFASASGDCTLRIWDVREPGSTMIIPAHDFEILSCDWNKYDDCILATSSVDKTVKVWDVRSYRVPLAVLNGHGYAVRKVKFSPHRRSLIASCSYDMSVCLWDYMVEDALVGRYDHHTEFAVGIDMSVLVEGLMASTGWDELVYVWQQGMDPRAS pex5_arath Peroxisome biogenesis protein 5 At5g56290 PEX5 Peroxin-5 Peroxisomal targeting signal type 1 receptor Pex5p MXK23.3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNANRSGPRPQFYSEDQQIRSLPGSELDQPLLQPGAQGSEFFRGFRSVDQNGLGAAWDEVQQGGPMPPMGPMFEPVQPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPVLGLSQSDKQCIRDRSSIMARHFFADRGEEFINSQVNALLSSLDIDDGIQARGHVPGRFRELDDYWNESQAVVKPNLHPADNWAAEFNQHGMDHGGPDSWVQSFEQQHGVNGWATEFEQGQSQLMSSQMRSMDMQNIAAMEQTRKLAHTLSQDGNPKFQNSRFLQFVSKMSRGELIIDENQVKQASAPGEWATEYEQQYLGPPSWADQFANEKLSHGPEQWADEFASGRGQQETAEDQWVNEFSKLNVDDWIDEFAEGPVGDSSADAWANAYDEFLNEKNAGKQTSGVYVFSDMNPYVGHPEPMKEGQELFRKGLLSEAALALEAEVMKNPENAEGWRLLGVTHAENDDDQQAIAAMMRAQEADPTNLEVLLALGVSHTNELEQATALKYLYGWLRNHPKYGAIAPPELADSLYHADIARLFNEASQLNPEDADVHIVLGVLYNLSREFDRAITSFQTALQLKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESIPYYVRALAMNPKADNAWQYLRLSLSCASRQDMIEACESRNLDLLQKEFPL thik2_arath 3-ketoacyl-CoA thiolase 2, peroxisomal PED1 KAT2 Acetyl-CoA acyltransferase 2 Beta-ketothiolase 2 Peroxisomal 3-oxoacyl-CoA thiolase 2 Peroxisome defective protein 1 F25I18.11 At2g33150 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKAIERQRVLLEHLRPSSSSSHNYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNPAVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPVKTKLVDPKTGDEKPITVSVDDGIRPTTTLASLGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR dci1_arath Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, peroxisomal DCI1 At5g43280 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTMESYKTLEIIRKNTDSSVFHLIINRPSHLNALSLDFFIEFPKALSSLDQNPDVSVIILSGAGKHFCSGIDLNSLSSISTQSSSGNDRGRSSEQLRRKIKSMQAAITAIEQCRKPVIAAIHGACIGGGVDLITACDIRYCSEDAFFSIKEVDLAIVADLGTLQRLPSIVGYANAMELALTARRFSGSEAKDLGLVSKVFGSKSELDNGVTTIAEGIGGKSPLAVTGTKAVLLRSREVSVEQGLDYVATWNSAMLISDDLNEAVSAQMMKRKPRFAKL pex14_arath Peroxisomal membrane protein PEX14 PEX14 PED2 Peroxin-14 Peroxisome biogenesis protein 14 Pex14p Protein PEROXISOME DEFECTIVE 2 MQB2.13 At5g62810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATHQQTQPPSDFPALADENSQIPEATKPANEVQQATIAQDPPTSVFKNSEPIREDQIQNAIKFLSHPRVRGSPVIHRRSFLERKGLTKEEIDEAFRRVPDPPPSSQTTVTTSQDGQQAVSTVQPQAMQPVVAAPAPLIVTPQAAFLSRFRWYHAILAVGVLAASGAGTAVFIKRSLIPRFKSWVQRIMLEEETDPLKKADAKPSLAEEAVAAAKAASAAASDVARVSQEMMITKNEERKYFEDLTHLLGVQVQEMKSLSNNIRKLEGQSNNIPKIYSADQEVYNGSVTTARKPYTNGSNVDYDTRSARSASPPAAPADSSAPPHPKSYMDIMSMIQRGEKPSNIREINDMPPNPNQPLSDPRIAPKSKPWDYGQAPQDESSNGQWWQQKNPRSTDFGYETTTAARFTANQNETSTMEPAAFQRQRSWVPPQPPPVAMAEAVEAIRRPKPQAKIDQEAAASDGQSGVSDELQKITKFSESGGDGSGGIKIAEIQEETEQQHISQEGN q0wus4_arath Malate dehydrogenase At2g22780 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPNQRIARISAHLNPPNLHNQIADGSGLNRVACRAKGGSPGFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVANAPGVTADISHMDTSAVVRGFLGQPQLEEALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLSEAIAKCCPKAIVNIISNPVNSTVPIAAEVFKKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVEVPVVGGHAGVTILPLLSQVKPPCSFTQKEIEYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAVEFADACLRGLRGDANIVECAYVASHVTELPFFASKVRLGRCGIDEVYGLGPLNEYERMGLEKAKKELSVSIHKGVTFAKK pex5-pex7 1539512 n/a PEX7 1539515 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PEX5 1539516 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3 The PEX5C terminal construct lacks residues 314 to 334 which are required for function as the PEX7 co-receptor [9]. As predicted, pull-down from the depleted cytosol with recombinant PEX5C did not co-isolate either PEX7 or thiolase cargo (Fig. 3B, anti-PEX7 and anti-thiolase panels). pex5-ped1 1539512 n/a thiolase PTS2-cargo 1539517 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a PEX5 1539516 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f3 The PEX5C terminal construct lacks residues 314 to 334 which are required for function as the PEX7 co-receptor [9]. As predicted, pull-down from the depleted cytosol with recombinant PEX5C did not co-isolate either PEX7 or thiolase cargo (Fig. 3B, anti-PEX7 and anti-thiolase panels). dci1-ped1 1539512 n/a PEX5 1539516 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a DCI1 1539518 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4a dci1-pex5 1539512 n/a PEX7 1539515 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level n/a DCI1 1539518 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4a dci1-ped1-1 1539512 n/a DCI1 1539518 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a thiolase PTS2-cargo 1539517 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4a dci1-pex5-1 1539512 n/a PEX14N 1539519 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a PEX5 1539516 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4c pex14-pex5-13 1539512 n/a PEX14N 1539519 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a PEX7 1539515 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4c dci1-pex7 1539512 n/a pMDH1 1539520 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a PEX7 1539515 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4B dci1-pex5-2 1539512 n/a pMDH1 1539520 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a PEX5 1539516 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4B pex14-pex5-12 1539513 n/a PEX14N 1539519 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his-strep tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a PEX5 1539516 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1b f1c A stable ternary PTS1-PEX5C-PEX14N complex was isolated (Fig 1B lane 1), and PEX14N could also co-isolate PEX5C in the absence of lissamine-PTS1 cargo (Fig. 1B, lane 2). The pull-down experiments were repeated utilising full-length PEX5. These experiments demonstrated that PEX5 was also capable of forming a stable ternary complex, or binding PEX14N in the absence of PTS1 cargo (Fig. 1C, lanes 1 and 2). pex5-pex14-5 1539514 n/a PEX14N 1539519 tag enzyme assay tag visualisation by enzyme assay tag enzyme assay unspecified role unspecified role prey prey purified purified hrp tag enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a PEX5 1539516 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1d A stable ternary PTS1-PEX5C-PEX14N complex was isolated (Fig 1B lane 1), and PEX14N could also co-isolate PEX5C in the absence of lissamine-PTS1 cargo (Fig. 1B, lane 2). The pull-down experiments were repeated utilising full-length PEX5. These experiments demonstrated that PEX5 was also capable of forming a stable ternary complex, or binding PEX14N in the absence of PTS1 cargo (Fig. 1C, lanes 1 and 2).