MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014o-1 Muscle Lim Protein isoform negatively regulates striated muscle actin dynamics and differentiation in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western dsanoudo@enders.tch.harvard.edu 2014 imex curation Vafiadaki E., Arvanitis D.A., Papalouka V., Terzis G., Roumeliotis T.I., Spengos K., Garbis S.D., Manta P., Kranias E.G., Sanoudou D. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014x-4 Muscle Lim Protein isoform negatively regulates striated muscle actin dynamics and differentiation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot dsanoudo@enders.tch.harvard.edu 2014 imex curation Vafiadaki E., Arvanitis D.A., Papalouka V., Terzis G., Roumeliotis T.I., Spengos K., Garbis S.D., Manta P., Kranias E.G., Sanoudou D. FEBS J. (1742-464X) Only protein-protein interactions csrp3_human Cysteine and glycine-rich protein 3 CLP Cardiac LIM protein Cysteine-rich protein 3 LIM domain protein, cardiac MLP Muscle LIM protein CSRP3 protein protein human Homo sapiens Human MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKGIGYGQGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE myod1_human Myoblast determination protein 1 Myogenic factor 3 MYOD1 MYF3 MYOD BHLHC1 Class C basic helix-loop-helix protein 1 protein protein human Homo sapiens Human MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPEEHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRPGKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQSPDAAPQCPAGANPNPIYQVL myog_human Myogenin MYOG BHLHC3 MYF4 Class C basic helix-loop-helix protein 3 Myogenic factor 4 protein protein human Homo sapiens Human MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN cof2_human Cofilin-2 CFL2 Cofilin, muscle isoform protein protein human Homo sapiens Human MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL actn2_human Alpha-actinin-2 ACTN2 Alpha-actinin skeletal muscle isoform 2 F-actin cross-linking protein protein protein human Homo sapiens Human MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRACLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL telt_human Telethonin Titin cap protein TCAP protein protein human Homo sapiens Human MATSELSCEVSEENCERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHQQGQCQVLVQRSPWLMMRMGILGRGLQEYQLPYQRVLPLPIFTPAKMGATKEEREDTPIQLQELLALETALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSMSQEAQRG csrp3-csrp3-3 1539740 n/a MLP-a 1539742 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a MLP-b 1539742 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f5b blot overlay assays with the GST-MLP-b were performed. Western blot analysis with the GST antibody determined that the isoform does not bind to MyoD or Myogenin (Fig. 5B), although it can directly bind MLP, as detected by its interaction with MBP-MLP-a recombinant protein (Fig. 5B). In a parallel set of blot overlay assays we confirmed previous reports on the direct interaction of full length MLP with MyoD and Myogenin (Fig. 5C). csrp3-myod1 1539740 n/a MyoD 1539743 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a MLP-a 1539742 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f5c myod1-csrp3 1539740 n/a MLP-a 1539742 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a Myogenin 1539744 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f5c csrp3-csrp3-1 1539740 n/a MLP-b 1539742 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a MLP inter-LIM 1539742 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f6e csrp3-csrp3-2 1539740 n/a CFL2 1539745 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a MLP-a 1539742 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f6g cfl2-csrp3 1539740 n/a MLP-a 1539742 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a CFL2 1539745 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f6h f6i we performed competition assays by blot overlay using His-CFL2 and MBP-MLP-a in the presence or absence of the GST-MLP-b. The MLP/CFL2 interaction remained unaffected by the presence of the MLP-b, indicating that the latter does not compete with CFL2 for binding to full length MLP (Fig. 6H-I). csrp3-actn2 1539741 n/a MLP 1539742 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a a-actinin 1539746 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level n/a T-Cap 1539747 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false f6c In parallel, we performed pull down assays using GST-MLP-a, which served as a positive control for these experiments (Fig. 6B). Western blot analysis of the pull down samples determined that MLP-b can bind both to α-actinin and Tcap (Fig. 6C).