MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014f-1 Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS in vitro In vitro protein kinase assay protein kinase assay ms participant Identification by mass spectrometry ms participant b.sorg@pharmchem.uni-frankfurt.de 2014 imex curation Markoutsa S., Sürün D., Karas M., Hofmann B., Steinhilber D., Sorg B.L. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014i-3 Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography b.sorg@pharmchem.uni-frankfurt.de 2014 imex curation Markoutsa S., Sürün D., Karas M., Hofmann B., Steinhilber D., Sorg B.L. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014i-2 Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot b.sorg@pharmchem.uni-frankfurt.de 2014 imex curation Markoutsa S., Sürün D., Karas M., Hofmann B., Steinhilber D., Sorg B.L. FEBS J. (1742-464X) Only protein-protein interactions mapk2_human MAP kinase-activated protein kinase 2 MAPKAPK2 protein protein human Homo sapiens Human MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH lox5_human Polyunsaturated fatty acid 5-lipoxygenase ALOX5 LOG5 Arachidonate 5-lipoxygenase protein protein human Homo sapiens Human MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI kapca_human cAMP-dependent protein kinase catalytic subunit alpha PRKACA PKACA protein protein human Homo sapiens Human MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF fgr_human Tyrosine-protein kinase Fgr SRC2 Proto-oncogene c-Fgr FGR p55-Fgr Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog p58-Fgr p58c-Fgr protein protein human Homo sapiens Human MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSLSSGKTGCIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAYSLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHYMEVNDGLCNLLIAPCTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSPKAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPEGQDLRLPQLVDMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT hck_human Tyrosine-protein kinase HCK HCK Hemopoietic cell kinase p59-HCK/p60-HCK Hematopoietic cell kinase p59Hck p61Hck protein protein human Homo sapiens Human MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP yes_human Tyrosine-protein kinase Yes p61-Yes Proto-oncogene c-Yes YES1 YES protein protein human Homo sapiens Human MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL kcc2g_human Calcium/calmodulin-dependent protein kinase type II subunit gamma CAMK CAMK-II CAMK2G CAMKG protein protein human Homo sapiens Human MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKGRVPEGRSSRDRTAPSAGMQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ alox5-mapkapk2 1498717 n/a MK2 1498720 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified n/a 5-LO 1498721 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component purified purified phoser271 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false Fig. 2, Table 1 P49137 is required for phosphorylation of P09917 P09917 Ser-271 O-phospho-L-serine alox5-mapkapk2-1 1498717 n/a PKA 1498722 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified n/a 5-LO 1498721 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component purified purified phoser670 porphres porphyrin modified residue PorphRes modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false phoser271 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false phoser523 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false phoser447 porphres porphyrin modified residue PorphRes modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false Table 1 P17612 is required for phosphorylation of P09917 P09917 Ser-271, Ser-447, Ser-523 and Ser-670 O-phospho-L-serine alox5-prkaca 1498717 n/a 5-LO 1498721 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component purified purified photyr42 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false photyr53 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false photyr445 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli n/a Fgr 1498723 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation false false false Table 2 P09769 is required for phosphorylation of P09917 P09917 Tyr-42, Tyr-53 and Tyr-445 O4'-phospho-L-tyrosine alox5-fgr 1498717 n/a 5-LO 1498721 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component purified purified photyr42 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false photyr94 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false photyr53 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli n/a HCK 1498724 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation false false false Table 2 P08631 is required for phosphorylation of P09917 P09919 Tyr-42, Tyr-53 an Tyr-94 O4'-phospho-L-tyrosine alox5-fgr-1 1498717 n/a Yes 1498725 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified n/a 5-LO 1498721 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component purified purified photyr445 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false photyr53 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false photyr42 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false Table 2 P07947 is required for phosphorylation of P09917 P09917 Tyr-42, Tyr-53 and Tyr-445 O4'-phospho-L-tyrosine alox5-hck 1498718 n/a 5-LO 1498721 autoradiography autoradiography enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecolx Escherichia coli n/a HCK 1498724 autoradiography autoradiography enzyme enzyme neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation false false false Fig. 5a alox5-hck-1 1498718 n/a Yes 1498725 autoradiography autoradiography enzyme enzyme neutral component neutral component purified purified n/a 5-LO 1498721 autoradiography autoradiography enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false Fig. 5b alox5-hck-2 1498718 n/a Fgr 1498723 autoradiography autoradiography enzyme enzyme neutral component neutral component purified purified n/a 5-LO 1498721 autoradiography autoradiography enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false Fig. 5c alox5-prkaca-1 1498719 n/a CaMK II 1498726 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified n/a 5-LO 1498721 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component purified purified phoser523 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false phoser271 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false Fig. 3b After in-vitro kinase assay with CaMK II and 5-LO, gel based MS analysis failed to detect any phosphopeptide. However, this is in contrast with immunoblotting experiments which indicated phosphorylation of 5-LO at both Ser271 and Ser523 (Fig. 3). Q13555 is required for phosphorylation of P09917 P09917 Ser-271 and Ser-523 O-phospho-L-serine alox5-prkaca-2 1498719 n/a PKA 1498722 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified n/a 5-LO 1498721 western blot western blot Immuno blot Immuno blot enzyme target enzyme target substrate substrate neutral component neutral component purified purified phoser523 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false phoser271 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false Fig. 3a P09917 Ser-271 and Ser-523 O-phospho-L-serine