MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014y-2 SUMO-1 modification regulates ATRA-induced differentiation via stabilization of RARα human-aml Human AML cells aml Acute myeloid leukemia cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mying@zju.edu.cn 2014 imex curation Zhou Q., Zhang L., Chen Z., Zhao P., Ma Y., Yang B., He Q., Ying M. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014za-1 SUMO-1 modification regulates ATRA-induced differentiation via stabilization of RARα human-aml Human AML cells aml Acute myeloid leukemia cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Mying@zju.edu.cn 2014 imex curation Zhou Q., Zhang L., Chen Z., Zhao P., Ma Y., Yang B., He Q., Ying M. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014v-4 SUMO-1 modification regulates ATRA-induced differentiation via stabilization of RARα chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Mying@zju.edu.cn 2014 imex curation Zhou Q., Zhang L., Chen Z., Zhao P., Ma Y., Yang B., He Q., Ying M. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014n-7 SUMO-1 modification regulates ATRA-induced differentiation via stabilization of RARα chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mying@zju.edu.cn 2014 imex curation Zhou Q., Zhang L., Chen Z., Zhao P., Ma Y., Yang B., He Q., Ying M. FEBS J. (1742-464X) Only protein-protein interactions sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV rara_human Retinoic acid receptor alpha RARA NR1B1 Nuclear receptor subfamily 1 group B member 1 protein protein human Homo sapiens Human MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP rara-sumo1-2 1537638 n/a SUMO1 1537642 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a RAR-alpha 1537643 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4b F4G To further determine whether RARα can be modified by SUMO-1, we performed a reciprocal immunoprecipitation assay in U2OS, HL60, and NB4 cells. As expected, immunoprecipitation of RARα resulted in the isolation of SUMO-1, while immunoprecipitation of SUMO-1 conversely identified RARα (Fig.4B). rara-sumo1-3 1537638 n/a RAR-alpha 1537643 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a SUMO1 1537642 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4b To further determine whether RARα can be modified by SUMO-1, we performed a reciprocal immunoprecipitation assay in U2OS, HL60, and NB4 cells. As expected, immunoprecipitation of RARα resulted in the isolation of SUMO-1, while immunoprecipitation of SUMO-1 conversely identified RARα (Fig.4B). rara-sumo1 1537639 n/a RAR-alpha 1537643 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell n/a SUMO1 1537642 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f4a we first assessed whether endogenous SUMO-1 interacts with endogenous RARα in U2OS, HL60, and NB4 cells using immunofluorescence analysis. As presented in Fig.4A, our results demonstrated that SUMO-1 (red) and RARα (green) localized in cells as clearly displayed in the merged immunofluorescence images (yellow), indicating a potential interaction between RARα and SUMO-1. sumo1-rara 1537640 n/a SUMO-1 1537642 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a RAR-alpha 1537643 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P10276:p.Lys399Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f4c f5c rara-sumo1-4 1537641 n/a SUMO-1 1537642 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a RAR-alpha 1537643 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P10276:p.Lys399Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f5b