MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014u-1 The electrostatic interactions of relaxin-3 with receptor RXFP4 and the influence of its B-chain C-terminal conformation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. competition binding competition binding tag visualisation tag visualisation zhan-yun.guo@tongji.edu.cn 2014 imex curation Wang X.Y., Guo Y.Q., Zhang W.J., Shao X.X., Liu Y.L., Xu Z.G., Guo Z.Y. FEBS J. (1742-464X) Only protein-protein interactions rl3r2_human Relaxin-3 receptor 2 RXFP4 GPR100 RLN3R2 G-protein coupled receptor 100 G-protein coupled receptor GPCR142 Insulin-like peptide INSL5 receptor Relaxin family peptide receptor 4 GPCR142 protein protein human Homo sapiens Human MPTLNTSASPPTFFWANASGGSVLSADDAPMPVKFLALRLMVALAYGLVGAIGLLGNLAVLWVLSNCARRAPGPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTATVLNVYASIFLITALSVARYWVVAMAAGPGTHLSLFWARIATLAVWAAAALVTVPTAVFGVEGEVCGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLGVITTSYLLLLAFLQRRQRRRQDSRVVARSVRILVASFFLCWFPNHVVTLWGVLVKFDLVPWNSTFYTIQTYVFPVTTCLAHSNSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG rel3_human Relaxin-3 RLN3 INSL7 RXN3 ZINS4 Insulin-like peptide INSL7 Prorelaxin H3 UNQ6188/PRO20213 protein protein human Homo sapiens Human MARYMLLLLLAVWVLTGELWPGAEARAAPYGVRLCGREFIRAVIFTCGGSRWRRSDILAHEAMGDTFPDADADEDSLAGELDEAMGSSEWLALTKSPQAFYRGRPSWQGTPGVLRGSRDVLAGLSSSCCKWGCSKSEISSLC rln3-rxfp4 1536996 n/a RXFP4 1536997 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q8TDU9:p.Glu100Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a relaxin-3 1536998 tag visualisation tag visualisation unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tag fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2 t1 rln3-rxfp4-1 1536996 n/a relaxin-3 1536998 tag visualisation tag visualisation unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tag fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a RXFP4 1536997 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q8TDU9:p.Asp104Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f2 t1 rln3-rxfp4-2 1536996 n/a RXFP4 1536997 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q8TDU9:p.Glu182Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a relaxin-3 1536998 tag visualisation tag visualisation unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tag fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2 t1 rln3-rxfp4-3 1536996 n/a relaxin-3 1536998 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q8WXF3:p.Arg37Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false tag fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a RXFP4 1536997 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false f4 t2 rln3-rxfp4-4 1536996 n/a RXFP4 1536997 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell n/a relaxin-3 1536998 tag visualisation tag visualisation unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q8WXF3:p.Arg41Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false tag fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4 t2 rln3-rxfp4-5 1536996 n/a relaxin-3 1536998 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q8WXF3:p.Arg51Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false tag fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a RXFP4 1536997 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false f4 t2 rln3-rxfp4-6 1536996 n/a relaxin-3 1536998 tag visualisation tag visualisation unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q8WXF3:p.Arg41Glu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false tag fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a RXFP4 1536997 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q8TDU9:p.Asp104Arg mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f5 t3 rln3-rxfp4-7 1536996 n/a relaxin-3 1536998 tag visualisation tag visualisation unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q8WXF3:p.Arg51Glu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false tag fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a RXFP4 1536997 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q8TDU9:p.Glu100Arg mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f5 t3 rln3-rxfp4-8 1536996 n/a relaxin-3 1536998 tag visualisation tag visualisation unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q8WXF3:p.Arg37Glu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false tag fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a RXFP4 1536997 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Q8TDU9:p.Asp104Arg mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f5 t3