MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint song-2014-1 A novel import route for an N-anchor mitochondrial outer membrane protein aided by the TIM23 complex. yeast Saccharomyces cerevisiae Baker's yeast fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Song J., Tamura Y., Yoshihisa T., Endo T. endo@chem.nagoya-u.ac.jp EMBO Rep. (1469-221X) 2014 imex curation Only protein-protein interactions om45_yeast Mitochondrial outer membrane protein OM45 OM45 YIL136W Outer membrane protein of 45 kDa protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSRIIVGSAALAAAITASIMVREQKAKGQRREGNVSAYYNGQEYGSSAPPQLGKLHNIKQGIKEDALSLKDALLGVSQKAREEAPKVTKRVISPEEDAQTRKQLGQKAKDSSSQSIFNWGFSEAERRKAIAIGEFDTAKKRFEEAVDRNEKELLSTVMREKKAALDRASIEYERYGRARDFNELSDKLDQQERNSNPLKRLLKNNTGDANTEEAAARSVQGWGDTAQEFGREELEEAKRNASSEPSEAQKRLDELKKIKEKGWFGYNKGEQSEQQIAERVARGLEGWGETAAQLSKDEMDDLRWNYENSKKQLDKNVSDAMDSLSKAKEDLKQYGSHWWSGWTSKVDNDKQALKDEAQKKYDEALKKYDEAKNKFKEWNDKGDGKFWSSKKD 77154D522E578225 tom40_yeast Mitochondrial import receptor subunit TOM40 TOM40 ISP42 YMR203W YM8325.04 MOM38 Mitochondrial import site protein ISP42 Translocase of outer membrane 40 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAPTPLAEASQIPTIPALSPLTAKQSKGNFFSSNPISSFVVDTYKQLHSHRQSLELVNPGTVENLNKEVSRDVFLSQYFFTGLRADLNKAFSMNPAFQTSHTFSIGSQALPKYAFSALFANDNLFAQGNIDNDLSVSGRLNYGWDKKNISKVNLQISDGQPTMCQLEQDYQASDFSVNVKTLNPSFSEKGEFTGVAVASFLQSVTPQLALGLETLYSRTDGSAPGDAGVSYLTRYVSKKQDWIFSGQLQANGALIASLWRKVAQNVEAGIETTLQAGMVPITDPLMGTPIGIQPTVEGSTTIGAKYEYRQSVYRGTLDSNGKVACFLERKVLPTLSVLFCGEIDHFKNDTKIGCGLQFETAGNQELLMLQQGLDADGNPLQALPQL om45-tom40 1572716 n/a 1572717 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell bindin range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1572718 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f2b