MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014d-5 Amyloidogenic Mutations in Human Apolipoprotein A-I are not Necessarily Destabilizing: A Common Mechanism of ApoA-I Misfolding in Familial Amyloidosis and Atherosclerosis in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined gursky@bu.edu 2014 imex curation Das M., Mei X., Jayaraman S., Atkinson D., Gursky O. FEBS J. (1742-464X) Only protein-protein interactions anonymous-2014h-4 Amyloidogenic Mutations in Human Apolipoprotein A-I are not Necessarily Destabilizing: A Common Mechanism of ApoA-I Misfolding in Familial Amyloidosis and Atherosclerosis in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined gursky@bu.edu 2014 imex curation Das M., Mei X., Jayaraman S., Atkinson D., Gursky O. FEBS J. (1742-464X) Only protein-protein interactions apoa1_human Apolipoprotein A-I APOA1 Apolipoprotein A1 protein protein human Homo sapiens Human MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ apoa1-apoa1-12 1533439 n/a apoA-I 1533441 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a apoA-I 1533441 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f5c Negative stain EM showed fibril formation after 6 days, followed by visible precipitation after 10 days. The fibrils were approximately 10 nm in width and hundreds of nm in length, and often formed clusters (Fig. 5C, left). apoa1-apoa1-13 1533440 n/a apoA-I 1533441 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a apoA-I 1533441 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f5c Binding of a diagnostic dye, thioflavine T (ThT), followed by fluorescence measurements showed a large increase in ThT emission upon the peptide aggregation leading to fibril formation (Fig. 5C, right).