MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2013u-1 Interaction between nucleophosmin and HBV core protein increases HBV capsid assembly in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot drjung@snu.ac.kr 2014 imex curation Jeong H., Cho M.H., Park S.G., Jung G. FEBS Lett. (0014-5793) Only protein-protein interactions anonymous-2013p-2 Interaction between nucleophosmin and HBV core protein increases HBV capsid assembly in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot drjung@snu.ac.kr 2014 imex curation Jeong H., Cho M.H., Park S.G., Jung G. FEBS Lett. (0014-5793) Only protein-protein interactions anonymous-2013i-4 Interaction between nucleophosmin and HBV core protein increases HBV capsid assembly in vitro In vitro bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot drjung@snu.ac.kr 2014 imex curation Jeong H., Cho M.H., Park S.G., Jung G. FEBS Lett. (0014-5793) Only protein-protein interactions npm_human Nucleophosmin NPM1 NPM Nucleolar phosphoprotein B23 Numatrin Nucleolar protein NO38 protein protein human Homo sapiens Human MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL b1q2w9_hbvdr Capsid protein Core antigen Core protein HBcAg p21.5 C pre-C/C protein protein hbvdr Hepatitis B virus subtype adr MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSRESQC npm1-pre_c_c 1477202 n/a B23 1477205 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified n/a Cp149 1477206 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false undefined mutation W125K mutation disrupting mutation disrupting interaction mutation disrupting undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1b npm1-pre_c_c-1 1477202 n/a B23 1477205 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified n/a Cp149 1477206 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false undefined mutation W125L mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1b npm1-pre_c_c-2 1477202 n/a B23 1477205 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified n/a Cp149 1477206 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified undefined mutation W125E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f1b pre_c_c-npm1 1477202 n/a B23 1477205 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified P06748:p.Asp286Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a Cp149 1477206 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f1c pre_c_c-npm1-1 1477202 n/a Cp149 1477206 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a B23 1477205 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified P06748:p.Cys21Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f4a f4b we used co11 immunoprecipitation analysis to examine whether oligomerization of B23 was necessary for its interaction with core protein. Given that the B23 mutant C21F is defective in oligomerization [19], C21F was used as a monomer in this analysis. The HBV core dimer could interact only with B23 oligomer but not with B23 monomer (Fig. 4A). These showed that the oligomerization of B23 was mandatory for its interaction with core protein. Consistent with the data, C21F (a monomeric form of B23) could not promote capsid assembly (Fig. 4B). npm1-pre_c_c-5 1477202 n/a B23 1477205 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified P06748:p.Cys21Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a Cp149 1477206 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f4a f4b we used co11 immunoprecipitation analysis to examine whether oligomerization of B23 was necessary for its interaction with core protein. Given that the B23 mutant C21F is defective in oligomerization [19], C21F was used as a monomer in this analysis. The HBV core dimer could interact only with B23 oligomer but not with B23 monomer (Fig. 4A). These showed that the oligomerization of B23 was mandatory for its interaction with core protein. Consistent with the data, C21F (a monomeric form of B23) could not promote capsid assembly (Fig. 4B). npm1-pre_c_c-3 1477203 n/a B23 1477205 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified P06748:p.Asp286Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a Cp149 1477206 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified undefined mutation W125K mutation disrupting mutation disrupting interaction mutation disrupting undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f1d npm1-pre_c_c-4 1477203 n/a Cp149 1477206 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 n/a B23 1477205 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 colocalization colocalization false false false f2b npm1-npm1 1477204 n/a B23 1477205 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified n/a B23 1477205 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false sf1d