IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ senatore-2012-1 Mutant PrP suppresses glutamatergic neurotransmission in cerebellar granule neurons by impairing membrane delivery of VGCC α(2)δ-1 Subunit. mouse-brain-cerebellum Mus musculus brain cerebellum brain_cerebellum [Cerebellar] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Senatore A., Colleoni S., Verderio C., Restelli E., Morini R., Condliffe S.B., Bertani I., Mantovani S., Canovi M., Micotti E., Forloni G., Dolphin A.C., Matteoli M., Gobbi M., Chiesa R. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. roberto.chiesa@marionegri.it Neuron (0896-6273) 2012 imex curation Only protein-protein interactions senatore-2012-2 Mutant PrP suppresses glutamatergic neurotransmission in cerebellar granule neurons by impairing membrane delivery of VGCC α(2)δ-1 Subunit. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Senatore A., Colleoni S., Verderio C., Restelli E., Morini R., Condliffe S.B., Bertani I., Mantovani S., Canovi M., Micotti E., Forloni G., Dolphin A.C., Matteoli M., Gobbi M., Chiesa R. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Location of Insertion mutation in figure 6 taken from PMID:7592679. roberto.chiesa@marionegri.it Neuron (0896-6273) 2012 Only protein-protein interactions imex curation senatore-2012-3 Mutant PrP suppresses glutamatergic neurotransmission in cerebellar granule neurons by impairing membrane delivery of VGCC α(2)δ-1 Subunit. mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Senatore A., Colleoni S., Verderio C., Restelli E., Morini R., Condliffe S.B., Bertani I., Mantovani S., Canovi M., Micotti E., Forloni G., Dolphin A.C., Matteoli M., Gobbi M., Chiesa R. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Cerebellar granule neurons from C57BL/6 mice. roberto.chiesa@marionegri.it Neuron (0896-6273) 2012 imex curation Only protein-protein interactions senatore-2012-4 Mutant PrP suppresses glutamatergic neurotransmission in cerebellar granule neurons by impairing membrane delivery of VGCC α(2)δ-1 Subunit. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Senatore A., Colleoni S., Verderio C., Restelli E., Morini R., Condliffe S.B., Bertani I., Mantovani S., Canovi M., Micotti E., Forloni G., Dolphin A.C., Matteoli M., Gobbi M., Chiesa R. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. roberto.chiesa@marionegri.it Neuron (0896-6273) 2012 imex curation Only protein-protein interactions ca2d1_mouse Voltage-dependent calcium channel subunit alpha-2/delta-1 Voltage-gated calcium channel subunit alpha-2/delta-1 Cacna2d1 Cacna2 protein protein mouse Mus musculus Mouse MAAGCLLALTLTLFQSGLIGPSSEEPFPSPVTIKSWVDKMQEDLVTLAKTASGVTQLADIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLAMEAEKVQAAHQWREDFASNEVVYYNAKDDLDPERNESEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKRNRDEDPTLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQDVSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDGGEERAQEIFAKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNVTGQSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKPIGVGIPTINLRKRRPNVQNPKSQEPVTLDFLDAELENEIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPREYCNDLKPSDNNTEFLLNFNEFIDRKTPNNPSCNTDLINRILLDAGFTNELVQNYWSKQKNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYVFTAPYFNKSGPGAYESGIMVSKAVELYIQGKLLKPAVVGIKIDVNSWIENFTKTSIRDPCAGPVCDCKRNSDVMDCVILDDGGFLLMANHDDYTNQIGRFFGEIDPSMMRHLVNISLYAFNKSYDYQSVCDPGAAPKQGAGHRSAYVPSIADILQIGWWATAAAWSILQQLLLSLTFPRLLEAVEMEEDDFTASLSKQSCITEQTQYFFKNDTKSFSGLLDCGNCSRIFHVEKLMNTNLVFIMVESKGTCPCDTRLLMQAEQTSDGPDPCDMVKQPRYRKGPDVCFDNNVLEDYTDCGGVSGLNPSLWSIFGLQFILLWLVSGSRHYLL prio_mouse Major prion protein PrP27-30 PrP33-35C Prnp Prn-p Prp protein protein mouse Mus musculus Mouse MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG ca2d1_rat Voltage-dependent calcium channel subunit alpha-2/delta-1 Cacna2d1 Cacnl2a Cchl2a Voltage-gated calcium channel subunit alpha-2/delta-1 protein protein rat Rattus norvegicus (Rat) Rat MAAGCLLALTLTLFQSWLIGPSSEEPFPSPVTIKSWVDKMQEDLVTLAKTASGVTQLADIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLAMEAEKVQAAHQWREDFASNEVVYYNAKDDLDPERNESESGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKRNRDEDPTLLWQVFAADRLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQDVSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFTFAFEQLLNYNVSRANCNKIIMLFTDGGEERAQEIFAKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNVTGQSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYRYLALVLPTYSFYYIKAKIEETITQARSKKGKMKDSETLKPDNFEESGYTFIAPREYCNDLKPSDNNTEFLLNFNEFIDRKTPNNPSCNTDLINRILLDAGFTNELVQNYWSKQKNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYVFTAPYFNKSGPGAYESGIMVSKAVELYIQGKLLKPAVVGIKIDVNSWIENFTKTSIRDPCAGPVCDCKRNSDVMDCVILDDGGFLLMANHDDYTNQIGRFFGEIDPRMMRHLVNISLYAFNKSYDYQSVCDPGAAPKQGAGHRSAYVPSITDILQIGWWATAAAWSILQQLLLSLTFPRLLEAVEMEEDDFTASLSKQSCITEQTQYFFKNDTKSFSGLLDCGNCSRIFHVEKLMNTNLVFIMVESKGTCPCDTRLLMQAEQTSDGPDPCDMVKQPRYRKGPDVCFDNNVLEDYTDCGGVSGLNPSLWSIFGLQFILLWLVSGSRHYLW prnp-cacna2d1-3 1530258 n/a 1530262 unspecified role unspecified role prey prey n/a 1530263 unspecified role unspecified role bait bait undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5A, Supp 5A An interaction was detected using Tg(WT) and Tg(PG14)- mice with a 72aa/octapeptide repeat insertion. After deglycosylation with PNGaseF, the observed band shifted to an apparent molecular weight of 107 kDa. cacna2d1-prnp-1 1530258 n/a 1530262 unspecified role unspecified role bait bait n/a 1530263 unspecified role unspecified role prey prey undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5Ai An interaction was detected using Tg(WT) and Tg(PG14)- mice with a 72aa/octapeptide repeat insertion. cacna2d1-prnp-2 1530259 n/a 1530263 unspecified role unspecified role neutral component neutral component undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false codon_34 gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag certain certain sequence position certain certain certain sequence position certain false n/a 1530264 immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6C Blocking PrP in the ER or Golgi by artificial retention signals resulted in intracellular retention of a2d-1, as with the PG14 mutation. cacna2d1-prnp-3 1530259 n/a 1530264 unspecified role unspecified role neutral component neutral component n/a 1530263 unspecified role unspecified role neutral component neutral component codon_34 gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation mutation insertion analysis insertion analysis range range range range false undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 6F/I In cells expressing PG14/Delta-HC PrP, (with a deletion of PrP hydrophobic Core aas 114-121), a2d-1 was more efficiently delivered to the cell surface. Transgenic mice that express a mouse PrP mutation D177N/V128 also show altered colocalisation, -as for PG14 cells, with less colocalisation visible at the cell surface. In cells co-expressing the Hydrophobic core deletion (aas 114-121) (with D177N/V128) this effect is not seen. prnp-cacna2d1-1 1530260 n/a 1530263 unspecified role unspecified role bait bait n/a 1530262 unspecified role unspecified role prey prey physical association physical association false false false Supp 5A prnp-cacna2d1-2 1530261 n/a 1530264 immunocytochemistry immunocytochemistry unspecified role unspecified role prey prey n/a 1530263 unspecified role unspecified role bait bait colocalization colocalization false false false Supp 5C