IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ petri-2011-1 PTPIP51, a positive modulator of the MAPK/Erk pathway, is upregulated in glioblastoma and interacts with 14-3-3β and PTP1B in situ. human-glioblastoma Homo sapiens glioblastoma glioblastoma Glioblastoma Glioblastoma is the same as 'Glioblastoma multiforme' (GBM) -is the same as Astrocytoma Grade 4. fluorescence imaging fluorescence microscopy fluorescence imaging immunohistochemistry immunohistochemistry Petri M.K., Koch P., Stenzinger A., Kuchelmeister K., Nestler U., Paradowska A., Steger K., Brobeil A., Viard M., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. Histol. Histopathol. (0213-3911) 2011 Only protein-protein interactions imex curation petri-2011-3 PTPIP51, a positive modulator of the MAPK/Erk pathway, is upregulated in glioblastoma and interacts with 14-3-3β and PTP1B in situ. human-glioblastoma Homo sapiens glioblastoma glioblastoma Glioblastoma Glioblastoma is the same as 'Glioblastoma multiforme' (GBM) -is the same as Astrocytoma Grade 4. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Petri M.K., Koch P., Stenzinger A., Kuchelmeister K., Nestler U., Paradowska A., Steger K., Brobeil A., Viard M., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. Histol. Histopathol. (0213-3911) 2011 Only protein-protein interactions imex curation petri-2011-2 PTPIP51, a positive modulator of the MAPK/Erk pathway, is upregulated in glioblastoma and interacts with 14-3-3β and PTP1B in situ. human-astrocytoma Human Astrocytoma astrocytoma astrocytoma fluorescence imaging fluorescence microscopy fluorescence imaging immunohistochemistry immunohistochemistry Petri M.K., Koch P., Stenzinger A., Kuchelmeister K., Nestler U., Paradowska A., Steger K., Brobeil A., Viard M., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. Histol. Histopathol. (0213-3911) 2011 Only protein-protein interactions imex curation petri-2011-4 PTPIP51, a positive modulator of the MAPK/Erk pathway, is upregulated in glioblastoma and interacts with 14-3-3β and PTP1B in situ. human-astrocytoma Human Astrocytoma astrocytoma astrocytoma pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Petri M.K., Koch P., Stenzinger A., Kuchelmeister K., Nestler U., Paradowska A., Steger K., Brobeil A., Viard M., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. Histol. Histopathol. (0213-3911) 2011 Only protein-protein interactions imex curation rmd3_human Regulator of microtubule dynamics protein 3 Protein tyrosine phosphatase-interacting protein 51 TCPTP-interacting protein 51 UNQ3122/PRO10274 hucep-10 RMDN3 Cerebral protein 10 FAM82A2 FAM82C PTPIP51 Protein FAM82A2 Protein FAM82C protein protein human Homo sapiens Human MSRLGALGGARAGLGLLLGTAAGLGFLCLLYSQRWKRTQRHGRSQSLPNSLDYTQTSDPGRHVMLLRAVPGGAGDASVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAGEIVGEVRCHMEENQRVARRRRFPFVRERSDSTGSSSVYFTASSGATFTDAESEGGYTTANAESDNERDSDKESEDGEDEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCHLWYAVLCGQLAEHESIQRRIQSGFSFKEHVDKAIALQPENPMAHFLLGRWCYQVSHLSWLEKKTATALLESPLSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLALELPDVTKEDLAIQKDLEELEVILRD 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN ptn1_human Tyrosine-protein phosphatase non-receptor type 1 PTPN1 PTP1B Protein-tyrosine phosphatase 1B protein protein human Homo sapiens Human MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT rmdn3-ywhab-1 1481421 n/a 1481425 unspecified role unspecified role neutral component neutral component n/a 1481426 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4A-C rmdn3-ywhab-5 1481421 n/a 1481425 unspecified role unspecified role neutral component neutral component n/a 1481427 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 5A-C co-localisation was seen around pseudo-glomerular vessels, endothelial cells and immune cells. rmdn3-ywhab-3 1481422 n/a 1481425 unspecified role unspecified role neutral component neutral component n/a 1481426 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 4G ptpn1-rmdn3 1481422 n/a 1481427 unspecified role unspecified role neutral component neutral component n/a 1481425 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5D co-localisation was seen around pseudo-glomerular vessels, endothelial cells and immune cells. rmdn3-ywhab-2 1481423 n/a 1481425 unspecified role unspecified role neutral component neutral component n/a 1481426 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4D-F rmdn3-ywhab-4 1481424 n/a 1481426 unspecified role unspecified role neutral component neutral component n/a 1481425 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 4H