UniProt UniProt http://www.uniprot.org cosson-2010-2 RTM3, which controls long-distance movement of potyviruses, is a member of a new plant gene family encoding a meprin and TRAF homology domain-containing protein. allium_epidermis Allium cepa (onion) epidermis A thin surface layer of tissue in higher plants formed by growth of a primary meristem. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Cosson P., Sofer L., Le Q.H., Léger V., Schurdi-Levraud V., Whitham S.A., Yamamoto M.L., Gopalan S., Le Gall O., Candresse T., Carrington J.C., Revers F. revers@bordeaux.inra.fr Plant Physiol. (0032-0889) 2010 imex curation Only protein-protein interactions cosson-2010-1 RTM3, which controls long-distance movement of potyviruses, is a member of a new plant gene family encoding a meprin and TRAF homology domain-containing protein. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cosson P., Sofer L., Le Q.H., Léger V., Schurdi-Levraud V., Whitham S.A., Yamamoto M.L., Gopalan S., Le Gall O., Candresse T., Carrington J.C., Revers F. revers@bordeaux.inra.fr Plant Physiol. (0032-0889) 2010 imex curation Only protein-protein interactions rtm3_arath Protein RESTRICTED TEV MOVEMENT 3 MATH domain and coiled-coil domain-containing protein RTM3 Restricted tobacco etch virus movement protein 3 F9D24.260 At3g58350 RTM3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGKQFDKKITWTIKNFASLLSDLIYSDHFVVGGCKWHLRAYPKGYNNANSLSLFLGVAVPTSLPSGWRRHTKFRLTLVNQLSDKLSQSKLNELEQWFDEKTTNWGLSSMCPLNEIHAKDSGFLLNGELKIVVEIKVLETIGKLDVTEETSTITETVDVNGFQLLPSQAKSVSRMFAKHPELASDLRPKNPNLRTGYMSLLLSLIETLSQLPQQMSKDDLLDAYDALGSMRDAGFKLDWLEKKLYEVSEKKENEEASETGLQEMEEELKDMKQKCLEMEALVEKEKAKVSTAKAPISFDDIV jal1_arath Protein RESTRICTED TEV MOVEMENT 1 RTM1 JAL1 Jacalin-related lectin 1 Restricted tobacco etch virus movement protein 1 T20M3.2 At1g05760 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKIGPVGKHDARSTTIVNWDEGSHDGFISQIFLSHGVAGIMSIQFQFVMDGKLVLSDRHGPFSGNMFDVIELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSPQFGGFHGTYDASGLQYIGVYLRPKTVLPKIDTGNAEETESKIVLG rtm1-rtm3 1533877 n/a 1533879 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1533880 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6 rtm1-rtm1 1533877 n/a 1533880 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1533880 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6 rtm3-rtm3-1 1533877 n/a 1533879 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1533879 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6 rtm3-rtm3 1533878 n/a 1533879 unspecified role unspecified role bait bait n/a 1533879 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5A, Fig. 5C rtm3-rtm1-1 1533878 n/a 1533879 unspecified role unspecified role bait bait D5K228:p.Glu284Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1533880 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5C