IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ xie-2010-3 Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. xie-2010-4 Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. xie-2010-1 Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. xie-2010-2 Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. in vitro In vitro crosslink cross-linking study crosslink weight silver stain molecular weight estimation by silver staining weight silver stain Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease DSS was used for cross-linking. Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. xie-2010-5 Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. in vitro In vitro fcs fluorescence correlation spectroscopy FCS FCS fcs predetermined predetermined participant predetermined Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease It is unclear if Syn has any tags other than N-terminal Dansyl chloride. There could be an additional GST, T7 or myc/His tags. Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. xie-2010-6 Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. xie-2010-7 Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease Chemical Shift Peturbation Experiment using increasing amounts of full length a-Syn. Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. xie-2010-8 Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. xie-2010-9 Interaction with synphilin-1 promotes inclusion formation of alpha-synuclein: mechanistic insights and pathological implication. in vitro In vitro electrophoresis electrophoretic mobility-based method electrophoresis weight by comassie molecular weight estimation by coomasie staining weight by comassie Xie Y.Y., Zhou C.J., Zhou Z.R., Hong J., Che M.X., Fu Q.S., Song A.X., Lin D.H., Hu H.Y. Parkinsons - Interactions investigated in the context of Parkinsons disease SDS-PAGE of protein containing eluate from column used for Molecular Sieving - from Experiment 7. Synuclein and synphilin-1 were confirmed to be Human by:- for synphilin - the length of the molecule, and for synuclein by blasting the sequence given in Figure 2C. hyhu@sibs.ac.cn FASEB J. (0892-6638) 2010 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. sncap_human Synphilin-1 Alpha-synuclein-interacting protein SNCAIP protein protein human Homo sapiens Human MEAPEYLDLDEIDFSDDISYSVTSLKTIPELCRRCDTQNEDRSVSSSSWNCGISTLITNTQKPTGIADVYSKFRPVKRVSPLKHQPETLENNESDDQKNQKVVEYQKGGESDLGPQPQELGPGDGVGGPPGKSSEPSTSLGELEHYDLDMDEILDVPYIKSSQQLASFTKVTSEKRILGLCTTINGLSGKACSTGSSESSSSNMAPFCVLSPVKSPHLRKASAVIHDQHKLSTEETEISPPLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFHLQSSAAESKPEEQVSGLNRTSSQGPEERSEYLKKVKSILNIVKEGQISLLPHLAADNLDKIHDENGNNLLHIAASQGHAECLQHLTSLMGEDCLNERNTEKLTPAGLAIKNGQLECVRWMVSETEAIAELSCSKDFPSLIHYAGCYGQEKILLWLLQFMQEQGISLDEVDQDGNSAVHVASQHGYLGCIQTLVEYGANVTMQNHAGEKPSQSAERQGHTLCSRYLVVVETCMSLASQVVKLTKQLKEQTVERVTLQNQLQQFLEAQKSEGKSLPSSPSSPSSPASRKSQWKSPDADDDSVAKSKPGVQEGIQVLGSLSASSRARPKAKDEDSDKILRQLLGKEISENVCTQEKLSLEFQDAQASSRNSKKIPLEKRELKLARLRQLMQRSLSESDTDSNNSEDPKTTPVRKADRPRPQPIVESVESMDSAESLHLMIKKHTLASGGRRFPFSIKASKSLDGHSPSPTSESSEPDLESQYPGSGSIPPNQPSGDPQQPSPDSTAAQKVATSPKSALKSPSSKRRTSQNLKLRVTFEEPVVQMEQPSLELNGEKDKDKGRTLQRTSTSNESGDQLKRPFGAFRSIMETLSGNQNNNNNYQAANQLKTSTLPLTSLGRKTDAKGNPASSASKGKNKAA syua_human Alpha-synuclein Non-A beta component of AD amyloid Non-A4 component of amyloid precursor SNCA NACP PARK1 protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA snca-sncaip-4 1480054 n/a 1480063 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1480064 unspecified role unspecified role bait bait n_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 2A, 2E. snca-sncaip-12 1480054 n/a 1480063 unspecified role unspecified role neutral component neutral component middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false 2A snca-sncaip-13 1480054 n/a 1480063 unspecified role unspecified role prey prey middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1480064 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 2A, 2E. sncaip-snca 1480055 n/a 1480063 unspecified role unspecified role neutral component neutral component cc_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1480064 unspecified role unspecified role neutral component neutral component n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) 1480092 1480088 direct interaction direct interaction false false false 2B, Supp Fig 1. snca-snca-8 1480055 n/a 1480063 unspecified role unspecified role neutral component neutral component middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) n/a 1480064 unspecified role unspecified role neutral component neutral component n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) 1480100 1480096 direct interaction direct interaction false false false supp 6 When a-Syn12 binds to GB1-Sph1M, its NOESY spectrum exhibits a number of transferred NOE peaks, wheras few NOEs are seen for a-Syn alone. snca-sncaip-14 1480055 n/a 1480063 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cys515_mtssl_paramagnetic-spin-label tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cc_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Supp 5 It is not clear if the His-tags have been removed from the 15N labeled SphCC proteins, or not. MTSSL (MTSL) - (1-Oxyl-2,2,5,5-tetramethylpyrroline-3- methyl)methanethiosulfonate. Paramagnetic spin labels affect nuclei near to the label, which show peak broadening and loss of signal intensity. Results here suggest an antiparallel dimer forms. snca-sncaip-5 1480056 n/a 1480064 unspecified role unspecified role bait bait n_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1480063 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 1B, 2D. snca-sncaip-9 1480056 n/a 1480064 unspecified role unspecified role bait bait n_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1480063 unspecified role unspecified role prey prey n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false 1B, 2D. i snca-sncaip-10 1480057 n/a 1480063 unspecified role unspecified role neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1480064 unspecified role unspecified role neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1C The synphilin dimer was also detected. However a-Syn can be cross-linked with monomeric GB1-Sph1M, indicating that the dimerization of Sph1M is likely to be irrelevant to its interaction with a-Syn. snca-sncaip-11 1480057 n/a 1480063 unspecified role unspecified role neutral component neutral component n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false middle_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false 1Ci The synphilin dimer was also detected. However a-Syn can be cross-linked with monomeric GB1-Sph1M, indicating that the dimerization of Sph1M is likely to be irrelevant to its interaction with a-Syn. sncaip-snca-1 1480058 n/a 1480063 unspecified role unspecified role neutral component neutral component Q9Y6H5:p.Ala519Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false cc1_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9Y6H5:p.Val523Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9Y6H5:p.Lys524Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9Y6H5:p.Lys527Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 n/a 1480064 unspecified role unspecified role neutral component neutral component n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P37840:p.Asp2Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P37840:p.Val3_Phe4delinsAlaAla mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1480145 1480140 direct interaction direct interaction false false false 1480058 3A/B/C/D Kd values for mutants (uM):-  A519N = 1.0  V523N =1.1  K524A = 1.1  K527A =1.1 a-Syn65 D2A = 1.8 snca-snca-7 1480058 n/a 1480063 unspecified role unspecified role neutral component neutral component cc1_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) ecoli Escherichia coli (strain K12) n/a 1480064 unspecified role unspecified role neutral component neutral component n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1480064 competitor competitor competitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 3B snca-sncaip-6 1480059 n/a 1480063 unspecified role unspecified role neutral component neutral component coiled_coil_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1480064 unspecified role unspecified role neutral component neutral component n_terminal_region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false 4/5 Sph1MDelta CC (residues 349–515) mainly forms nuclear bodies with no s-syn present. sncaip-snca-2 1480060 n/a 1480064 unspecified role unspecified role neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1480063 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false possible_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) cc_construct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 7A snca-sncaip-7 1480061 n/a 1480063 unspecified role unspecified role neutral component neutral component Q9Y6H5:p.Leu529Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9Y6H5:p.Leu525Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) Q9Y6H5:p.Leu518Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false cc_construct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false 7B snca-sncaip-8 1480062 n/a 1480063 unspecified role unspecified role neutral component neutral component cc_construct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9Y6H5:p.Leu529Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n_terminus_gb1_tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 56-residue B1 immunoglobulin binding domain of Streptococcal protein G (GB1) Q9Y6H5:p.Leu525Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9Y6H5:p.Leu518Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Supp 7