IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kulathila-2009-1 The structure of the BIR3 domain of cIAP1 in complex with the N-terminal peptides of SMAC and caspase-9. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kulathila R., Vash B., Sage D., Cornell-Kennon S., Wright K., Koehn J., Stams T., Clark K., Price A. priceal@emmanuel.edu Acta Crystallogr. D Biol. Crystallogr. (0907-4449) 2009 Only protein-protein interactions imex curation kulathila-2009-2 The structure of the BIR3 domain of cIAP1 in complex with the N-terminal peptides of SMAC and caspase-9. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kulathila R., Vash B., Sage D., Cornell-Kennon S., Wright K., Koehn J., Stams T., Clark K., Price A. In the materials and methods section the authors define the cIAP1/BIRC2 construct used for crystallization as residues 250-352, however based on the data deposited in pdb and further discussion in the publication, the used construct maps to residues 260-352 of cIAP1/BIRC2. priceal@emmanuel.edu Acta Crystallogr. D Biol. Crystallogr. (0907-4449) 2009 Only protein-protein interactions imex curation casp9_human Caspase-9 ICE-like apoptotic protease 6 Apoptotic protease Mch-6 Apoptotic protease-activating factor 3 CASP9 MCH6 protein protein human Homo sapiens Human MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS birc2_human Baculoviral IAP repeat-containing protein 2 Inhibitor of apoptosis protein 2 TNFR2-TRAF-signaling complex protein 2 IAP homolog B RING finger protein 48 BIRC2 API1 MIHB RNF48 RING-type E3 ubiquitin transferase BIRC2 Cellular inhibitor of apoptosis 1 protein protein human Homo sapiens Human MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTTGENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS dbloh_human Diablo homolog, mitochondrial Second mitochondria-derived activator of caspase Direct IAP-binding protein with low pI DIABLO SMAC protein protein human Homo sapiens Human MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED birc2-casp9-3 1478088 n/a 1478090 unspecified role unspecified role prey prey lig_bir_iii_2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 n/a 1478091 unspecified role unspecified role bait bait bir domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 1.0 1478097 1478095 direct interaction direct interaction false false false 1478088 Fig. 1 Temp = 25C; pH = 7.4 birc2-diablo-3 1478088 n/a 1478092 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 n/a 1478091 unspecified role unspecified role bait bait bir domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 1.0 1478103 1478101 direct interaction direct interaction false false false 1478088 Fig. 1 Temp = 25C; pH = 7.4 birc2-casp9-4 1478089 n/a 1478091 unspecified role unspecified role neutral component neutral component bir domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gpgs-tag n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 1.0 n/a 1478090 unspecified role unspecified role neutral component neutral component lig_bir_iii_2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 1478110 1478107 direct interaction direct interaction false false false Table 1 1.50A working 18.3%, free 20.5% birc2-diablo-4 1478089 n/a 1478091 unspecified role unspecified role neutral component neutral component bir domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gpgs-tag n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 1.0 n/a 1478092 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 1478116 1478113 direct interaction direct interaction false false false Table 1 2.30A working 20.1%, free 25.6%