UniProt UniProt http://www.uniprot.org page-1999-1 Interaction partners of Dlk/ZIP kinase: co-expression of Dlk/ZIP kinase and Par-4 results in cytoplasmic retention and apoptosis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Page G., Kögel D., Rangnekar V., Scheidtmann K.H. 'Tropomyosin alpha' (found as prey in Y2H screen) cannot be mapped to UniProt. Origin and coordinates of par-4 delta leu.zip (fig 7, immunofluorescence) according pmid 9199316. n/a SV40-transformed rat fibroblast cDNA Oncogene (0950-9232) 1999 imex curation Only protein-protein interactions page-1999-4 Interaction partners of Dlk/ZIP kinase: co-expression of Dlk/ZIP kinase and Par-4 results in cytoplasmic retention and apoptosis. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Page G., Kögel D., Rangnekar V., Scheidtmann K.H. 'Tropomyosin alpha' (found as prey in Y2H screen) cannot be mapped to UniProt. Origin and coordinates of par-4 delta leu.zip (fig 7, immunofluorescence) according pmid 9199316. n/a SV40-transformed rat fibroblast cDNA Oncogene (0950-9232) 1999 imex curation Only protein-protein interactions page-1999-2 Interaction partners of Dlk/ZIP kinase: co-expression of Dlk/ZIP kinase and Par-4 results in cytoplasmic retention and apoptosis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Page G., Kögel D., Rangnekar V., Scheidtmann K.H. 'Tropomyosin alpha' (found as prey in Y2H screen) cannot be mapped to UniProt. Origin and coordinates of par-4 delta leu.zip (fig 7, immunofluorescence) according pmid 9199316. n/a SV40-transformed rat fibroblast cDNA Oncogene (0950-9232) 1999 imex curation Only protein-protein interactions page-1999-3 Interaction partners of Dlk/ZIP kinase: co-expression of Dlk/ZIP kinase and Par-4 results in cytoplasmic retention and apoptosis. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Page G., Kögel D., Rangnekar V., Scheidtmann K.H. 'Tropomyosin alpha' (found as prey in Y2H screen) cannot be mapped to UniProt. Origin and coordinates of par-4 delta leu.zip (fig 7, immunofluorescence) according pmid 9199316. n/a SV40-transformed rat fibroblast cDNA Oncogene (0950-9232) 1999 imex curation Only protein-protein interactions page-1999-5 Interaction partners of Dlk/ZIP kinase: co-expression of Dlk/ZIP kinase and Par-4 results in cytoplasmic retention and apoptosis. rat-ref52 Rattus norvegicus embryonic fibroblast cells ref52 Rattus norvegicus embryonic fibroblast cell line fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Page G., Kögel D., Rangnekar V., Scheidtmann K.H. 'Tropomyosin alpha' (found as prey in Y2H screen) cannot be mapped to UniProt. Origin and coordinates of par-4 delta leu.zip (fig 7, immunofluorescence) according pmid 9199316. n/a SV40-transformed rat fibroblast cDNA Oncogene (0950-9232) 1999 imex curation Only protein-protein interactions pawr_rat PRKC apoptosis WT1 regulator protein Prostate apoptosis response 4 protein Transcriptional repressor Par-4-like protein PAWR Pawr Par4 protein protein rat Rattus norvegicus (Rat) Rat MATGGYRSSGSTTDFLEEWKAKREKMRAKQNPVGPGSSGGDPAAKSPAGPLAQTTAAGTSELNHGPAGAAAPAAPGPGALNCAHGSSALPRGAPGSRRPEDECPIAAGAAGAPASRGDEEEPDSAPEKGRSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAASLPDPGTSYLPQDPSRTVPGRYKSTISAPEEEILNRYPRTDRSGFSRHNRDTSAPANFASSSTLEKRIEDLEKEVLRERQENLRLTRLMQDKEEMIGKLKEEIDLLNRDLDDMEDENEQLKQENKTLLKVVGQLTR dapk3_rat Death-associated protein kinase 3 Dapk3 Zipk DAP-like kinase ZIP-kinase MYPT1 kinase protein protein rat Rattus norvegicus (Rat) Rat MSTFRQEDVEDHYEMGEELGSGQFAIVRKCQQKGTGMEYAAKFIKKRRLPSSRRGVSREEIEREVSILREIRHPNIITLHDVFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSSTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKVRRREDGARKPERRRLRAARLREYSLKSHSSMPRNTSYASFERFSRVLEDVAAAEQGLRELQRGRRQCRERVCALRVAAEQREARCRDGSAGLGRDLRRLRTELGRTEALRTRAQEEARAALLGAGGLKRRLCRLENRYDALAAQVAAEVQFVRDLVRALEQERLQAECGVR atf4_rat Cyclic AMP-dependent transcription factor ATF-4 Atf4 Activating transcription factor 4 protein protein rat Rattus norvegicus (Rat) Rat MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAGSSEWLAMDGLVSASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLATLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESVIKVDQAAPFTFLQPLPCSPGFLSSTPDHSFSLELGSEVDISEGDRKPDSAAYITLTPQCVKEEDTPSDSDSGICMSPESYLGSPQHSPSTSRAPPDSLPSPGVPRGSRPKPYDPPGVSVTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP rab3i_rat Rab-3A-interacting protein Rab3ip Rabin3 Rabin-3 SSX2-interacting protein Rabin8 protein protein rat Rattus norvegicus (Rat) Rat MANDPLEGFHEVNLASPTSPDLLGVCDPGTQEQTTSPSVIYRPHPSTLCSATIQANALNLSDLPTQPVYSSPRHLNCAEISNISIHVPEPASSVASEVAAGLTRFTSRKDSCNAEREFLQGATVTEASAGNDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANVKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLAAGKTPFKRGHTRNKSTSSAMSGSHQDFSAIQPIVKDCREADLSLYNEFRSWKDEPTMDRTCPFLDKIYQEDIFPCLTFAKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKPCKHRIKLGDSSSYYYISPVCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL dapk3-pawr-4 1565185 n/a 1565190 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1565191 unspecified role unspecified role bait bait physical association physical association false false false no figure dapk3-atf4-2 1565185 n/a 1565192 unspecified role unspecified role prey prey n/a 1565191 unspecified role unspecified role bait bait physical association physical association false false false no figure dapk3-rab3ip 1565185 n/a 1565193 unspecified role unspecified role prey prey n/a 1565191 unspecified role unspecified role bait bait physical association physical association false false false no figure dapk3-pawr-6 1565186 n/a 1565190 enzyme target enzyme target substrate substrate neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1565191 enzyme enzyme neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association false false false 3 dapk3-pawr-7 1565186 n/a 1565191 putative self putative self neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 3 dapk3-pawr-5 1565187 n/a 1565191 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1565190 unspecified role unspecified role prey prey physical association physical association false false false 1 pawr-dapk3 1565188 n/a 1565190 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1565191 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 2 dapk3-pawr-9 1565189 n/a 1565191 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false O88764:p.Lys42Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 1565190 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5 and 7