IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ engelender-1999-2 Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Engelender S., Kaminsky Z., Guo X., Sharp A.H., Amaravi R.K., Kleiderlein J.J., Margolis R.L., Troncoso J.C., Lanahan A.A., Worley P.F., Dawson V.L., Dawson T.M., Ross C.A. Parkinsons - Interactions investigated in the context of Parkinsons disease SNCA has been entered as being of Human origin due to mutation mapping. caross@jhu.edu Nat. Genet. (1061-4036) 1999 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. engelender-1999-3 Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Engelender S., Kaminsky Z., Guo X., Sharp A.H., Amaravi R.K., Kleiderlein J.J., Margolis R.L., Troncoso J.C., Lanahan A.A., Worley P.F., Dawson V.L., Dawson T.M., Ross C.A. Parkinsons - Interactions investigated in the context of Parkinsons disease SNCA has been entered as being of Human origin due to mutation mapping. caross@jhu.edu Nat. Genet. (1061-4036) 1999 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. engelender-1999-7 Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Engelender S., Kaminsky Z., Guo X., Sharp A.H., Amaravi R.K., Kleiderlein J.J., Margolis R.L., Troncoso J.C., Lanahan A.A., Worley P.F., Dawson V.L., Dawson T.M., Ross C.A. Parkinsons - Interactions investigated in the context of Parkinsons disease SNCA has been entered as being of Human origin due to mutation mapping. caross@jhu.edu Nat. Genet. (1061-4036) 1999 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. engelender-1999-1 Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Engelender S., Kaminsky Z., Guo X., Sharp A.H., Amaravi R.K., Kleiderlein J.J., Margolis R.L., Troncoso J.C., Lanahan A.A., Worley P.F., Dawson V.L., Dawson T.M., Ross C.A. Parkinsons - Interactions investigated in the context of Parkinsons disease SNCA has been entered as being of Human origin due to mutation mapping. caross@jhu.edu Fetal human brain library Nat. Genet. (1061-4036) 1999 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. engelender-1999-4 Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions. rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Engelender S., Kaminsky Z., Guo X., Sharp A.H., Amaravi R.K., Kleiderlein J.J., Margolis R.L., Troncoso J.C., Lanahan A.A., Worley P.F., Dawson V.L., Dawson T.M., Ross C.A. Parkinsons - Interactions investigated in the context of Parkinsons disease SNCA has been entered as being of Human origin due to mutation mapping. caross@jhu.edu Nat. Genet. (1061-4036) 1999 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. engelender-1999-5 Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Engelender S., Kaminsky Z., Guo X., Sharp A.H., Amaravi R.K., Kleiderlein J.J., Margolis R.L., Troncoso J.C., Lanahan A.A., Worley P.F., Dawson V.L., Dawson T.M., Ross C.A. Parkinsons - Interactions investigated in the context of Parkinsons disease SNCA has been entered as being of Human origin due to mutation mapping. caross@jhu.edu Nat. Genet. (1061-4036) 1999 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. engelender-1999-6 Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Engelender S., Kaminsky Z., Guo X., Sharp A.H., Amaravi R.K., Kleiderlein J.J., Margolis R.L., Troncoso J.C., Lanahan A.A., Worley P.F., Dawson V.L., Dawson T.M., Ross C.A. Parkinsons - Interactions investigated in the context of Parkinsons disease SNCA has been entered as being of Human origin due to mutation mapping. caross@jhu.edu Nat. Genet. (1061-4036) 1999 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. syua_human Alpha-synuclein Non-A beta component of AD amyloid Non-A4 component of amyloid precursor SNCA NACP PARK1 protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA sncap_human Synphilin-1 Alpha-synuclein-interacting protein SNCAIP protein protein human Homo sapiens Human MEAPEYLDLDEIDFSDDISYSVTSLKTIPELCRRCDTQNEDRSVSSSSWNCGISTLITNTQKPTGIADVYSKFRPVKRVSPLKHQPETLENNESDDQKNQKVVEYQKGGESDLGPQPQELGPGDGVGGPPGKSSEPSTSLGELEHYDLDMDEILDVPYIKSSQQLASFTKVTSEKRILGLCTTINGLSGKACSTGSSESSSSNMAPFCVLSPVKSPHLRKASAVIHDQHKLSTEETEISPPLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFHLQSSAAESKPEEQVSGLNRTSSQGPEERSEYLKKVKSILNIVKEGQISLLPHLAADNLDKIHDENGNNLLHIAASQGHAECLQHLTSLMGEDCLNERNTEKLTPAGLAIKNGQLECVRWMVSETEAIAELSCSKDFPSLIHYAGCYGQEKILLWLLQFMQEQGISLDEVDQDGNSAVHVASQHGYLGCIQTLVEYGANVTMQNHAGEKPSQSAERQGHTLCSRYLVVVETCMSLASQVVKLTKQLKEQTVERVTLQNQLQQFLEAQKSEGKSLPSSPSSPSSPASRKSQWKSPDADDDSVAKSKPGVQEGIQVLGSLSASSRARPKAKDEDSDKILRQLLGKEISENVCTQEKLSLEFQDAQASSRNSKKIPLEKRELKLARLRQLMQRSLSESDTDSNNSEDPKTTPVRKADRPRPQPIVESVESMDSAESLHLMIKKHTLASGGRRFPFSIKASKSLDGHSPSPTSESSEPDLESQYPGSGSIPPNQPSGDPQQPSPDSTAAQKVATSPKSALKSPSSKRRTSQNLKLRVTFEEPVVQMEQPSLELNGEKDKDKGRTLQRTSTSNESGDQLKRPFGAFRSIMETLSGNQNNNNNYQAANQLKTSTLPLTSLGRKTDAKGNPASSASKGKNKAA d3zwq5_rat Sncaip Sncaip_predicted rCG_46654 protein protein rat Rattus norvegicus (Rat) Rat MEAPEYLDLDEIDFSDDISYSVTSLKTIPALCRRCDSQNEDRPVSSSSWNCGVSTLITNPQKPTGIADVYSKFRPVKRVSPLKHQPETLESNESDDQKNNTVEYQKGGETDQGPQPEELSPEDGVGGLPGKGSEPSQALGELEHYDLDMDEILDVPYIKSSQQLAPLTKVTSEKRILGLCTTVNGLSAKTCPIVSAETSTPNMAPLCVLSPVKSPHLRKVPSVLRDQHKLPAEESENSPAPGKCGPAFESENHSKDFLNKVFSDPHSRKAEKSGPDCKLRPFRLQTSAAGAKPEEQVNGVSWASAQGAEERTEYLQKVRSILNIVNEGQISLLPHLAADNLDKIHDENGNNLLHVAASKGHAECLQHLTSLMGEDCLNERNAEQLTPAGLAIKNGQLECVRWMVSETEAIAELSCSKDFPSLIHYAGCYGQEKILLWLLQFMQEQGISLDEVDQEGNSAVHVASQHGYLGCIQTLVEYGANVTMQNHAGEKPSQSAERHGHTLCSRYLVVVETCMSLASQVVKLTKQLKEQTVERVTLQSQLQQLLEAQKSEGKSLPSSPSSPSSPASRKSQWKILDADDESTGKSKLGTQEGIQVLGNLSSRARTKGKDEDSDKILRQLLGKEISENVCTQEKLSLEFQDAQVSSRNSKKIPLEKRELKLARLRQLMQRSLSESDTDSNNSEDPKNTPVKRVDRPRPQPIVESVENMDSAESLHLMIKKHSVASGRRFPFGMKASKSLDGHSPSPTSESSEPDLDSHCPSLGMTPPTQPSTEATQCSPDSATAQKVATSPKSALKSPSSKRRTSQNSKLRVTFEEPVVQMEQTSLELNGEKDKERGRAPQRTSESGEQMKRPFGTFRSIMESLSGNQNNNNNYQPASQLKTCTLPLTSLGRKTADAKGNPVSPASKGKNKAAMYSSCIHLPSNALVEEHLRDYARLNDIKRNTKKTYNVKHIAEPEPKELFL syub_human Beta-synuclein SNCB protein protein human Homo sapiens Human MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA syua_rat Alpha-synuclein Snca protein protein rat Rattus norvegicus (Rat) Rat MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA snca-sncaip-16 1480192 n/a 1480199 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P37840:p.Ala53Thr mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false n/a 1480200 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1480209 1480206 physical association physical association false false false 1B/C/D snca-sncaip-17 1480192 n/a 1480200 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1480199 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1D snca-sncaip-18 1480193 n/a 1480199 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1480201 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association false false false 3C snca-sncaip-19 1480193 n/a 1480200 unspecified role unspecified role prey prey human-brain Homo sapiens brain brain Brain [cerebrum] n/a 1480199 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3C snca-sncaip-31 1480194 n/a 1480200 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1480199 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3B snca-sncaip-32 1480194 n/a 1480202 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1480200 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3Bi weak interaction snca-sncaip-15 1480195 n/a 1480200 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1480199 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1480239 1480237 physical association physical association false false false 1 and 2 snca-sncaip-20 1480196 n/a 1480201 unspecified role unspecified role prey prey n/a 1480203 unspecified role unspecified role bait bait physical association physical association false false false 3D snca-sncaip-27 1480197 n/a 1480199 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nac-non-alpha-beta_ component_of_alzheimer_disease_amyloid_plaque sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1480200 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 5C/D snca-sncaip-30 1480198 n/a 1480200 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1480199 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3A