UniProt UniProt http://www.uniprot.org rouault-1998-4 Interaction of BTG1 and p53-regulated BTG2 gene products with mCaf1, the murine homolog of a component of the yeast CCR4 transcriptional regulatory complex. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rouault J.P., Prévôt D., Berthet C., Birot A.M., Billaud M., Magaud J.P., Corbo L. corbo@lyon.fnclcc.fr J. Biol. Chem. (0021-9258) 1998 mimix curation rouault-1998-2 Interaction of BTG1 and p53-regulated BTG2 gene products with mCaf1, the murine homolog of a component of the yeast CCR4 transcriptional regulatory complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rouault J.P., Prévôt D., Berthet C., Birot A.M., Billaud M., Magaud J.P., Corbo L. corbo@lyon.fnclcc.fr J. Biol. Chem. (0021-9258) 1998 mimix curation rouault-1998-3 Interaction of BTG1 and p53-regulated BTG2 gene products with mCaf1, the murine homolog of a component of the yeast CCR4 transcriptional regulatory complex. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Rouault J.P., Prévôt D., Berthet C., Birot A.M., Billaud M., Magaud J.P., Corbo L. corbo@lyon.fnclcc.fr J. Biol. Chem. (0021-9258) 1998 mimix curation rouault-1998-1 Interaction of BTG1 and p53-regulated BTG2 gene products with mCaf1, the murine homolog of a component of the yeast CCR4 transcriptional regulatory complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Rouault J.P., Prévôt D., Berthet C., Birot A.M., Billaud M., Magaud J.P., Corbo L. corbo@lyon.fnclcc.fr mouse embryo cDNA library J. Biol. Chem. (0021-9258) 1998 mimix curation cnot7_mouse CCR4-NOT transcription complex subunit 7 CCR4-associated factor 1 Cnot7 Caf1 protein protein mouse Mus musculus Mouse MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEASKQS btg1_human Protein BTG1 BTG1 B-cell translocation gene 1 protein protein protein human Homo sapiens Human MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG btg2_human Protein BTG2 BTG family member 2 NGF-inducible anti-proliferative protein PC3 BTG2 PC3 protein protein human Homo sapiens Human MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS btg1-cnot7-3 1374690 n/a 1374694 unspecified role unspecified role prey prey n/a 1374695 unspecified role unspecified role bait bait physical association physical association false false false 3b btg2-cnot7-2 1374690 n/a 1374694 unspecified role unspecified role prey prey n/a 1374696 unspecified role unspecified role bait bait physical association physical association false false false 3b cnot7-btg1-1 1374690 n/a 1374694 unspecified role unspecified role bait bait n/a 1374695 unspecified role unspecified role prey prey physical association physical association false false false 3b cnot7-btg2 1374690 n/a 1374694 unspecified role unspecified role bait bait n/a 1374696 unspecified role unspecified role prey prey physical association physical association false false false 3b btg1-cnot7-1 1374691 n/a 1374694 unspecified role unspecified role prey prey n/a 1374695 unspecified role unspecified role bait bait physical association physical association false false false 1 btg2-cnot7 1374691 n/a 1374694 unspecified role unspecified role prey prey n/a 1374696 unspecified role unspecified role bait bait physical association physical association false false false no figure btg2-cnot7-1 1374692 n/a 1374694 unspecified role unspecified role prey prey n/a 1374696 unspecified role unspecified role bait bait direct interaction direct interaction false false false 2b btg1-cnot7-2 1374692 n/a 1374694 unspecified role unspecified role prey prey n/a 1374695 unspecified role unspecified role bait bait direct interaction direct interaction false false false 2b btg1-cnot7 1374693 n/a 1374694 unspecified role unspecified role prey prey n/a 1374695 unspecified role unspecified role bait bait physical association physical association false false false no figure