MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint roc_o-2013-1 Structure, biochemical characterization and analysis of the pleomorphism of carboxylesterase Cest-2923 from Lactobacillus plantarum WCFS1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Benavente R., Esteban-Torres M., Acebrón I., de Las Rivas B., Muñoz R., Alvarez Y., Mancheño J.M. xjosemi@iqfr.csic.es FEBS J. (1742-464X) 2013 Only protein-protein interactions imex curation roc_o-2013-2 Structure, biochemical characterization and analysis of the pleomorphism of carboxylesterase Cest-2923 from Lactobacillus plantarum WCFS1 in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Benavente R., Esteban-Torres M., Acebrón I., de Las Rivas B., Muñoz R., Alvarez Y., Mancheño J.M. xjosemi@iqfr.csic.es FEBS J. (1742-464X) 2013 Only protein-protein interactions imex curation f9us10_lacpl lp_2923 protein protein lacpl Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) MQVEQRTLNTAAHPFQITAYWLDQISDFETAVDYPIMIICPGGGFTYHSGREEAPIATRMMAAGMHTVVLNYQLIVGDQSVYPWALQQLGATIDWITTQASAHHVDCQRIILAGFSAGGHVVATYNGVATQPELRTRYHLDHYQGQHAAIILGYPVIDLTAGFPTTSAARNQITTDARLWAAQRLVTPASKPAFVWQTATDESVPPINSLKYVQAMLQHQVATAYHLFGSGIHGLALANHVTQKPGKDKYLNDQAAIWPQLALRWLQEQGLLAGNY f9us10 1446158 n/a Cest-2923 1446160 unspecified role unspecified role neutral component neutral component purified purified tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false t1 f2 f3 f4 Combining the results derived from these two distinct experimental approaches (crystallographic and analytical ultracentrifugation) we can deduce that Cest-2923 behaves in solution as an associative system well described by two equilibria, namely, a fast equilibrium between species with molecular masses consistent with monomers and dimers and another, much faster one between dimeric and tetrameric species, and secondly that the crystallization process is an active player in selecting a preexisting oligomeric form: dimers at neutral conditions, tetramers at acidic ones. f9us10-1 1446158 n/a Cest-2923 1446160 unspecified role unspecified role neutral component neutral component purified purified tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 direct interaction direct interaction false false false t1 f4b Combining the results derived from these two distinct experimental approaches (crystallographic and analytical ultracentrifugation) we can deduce that Cest-2923 behaves in solution as an associative system well described by two equilibria, namely, a fast equilibrium between species with molecular masses consistent with monomers and dimers and another, much faster one between dimeric and tetrameric species, and secondly that the crystallization process is an active player in selecting a preexisting oligomeric form: dimers at neutral conditions, tetramers at acidic ones. f9us10-1 1446159 n/a Cest-2923 1446160 unspecified role unspecified role neutral component neutral component purified purified tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 direct interaction direct interaction false false false f5 sf3 Combining the results derived from these two distinct experimental approaches (crystallographic and analytical ultracentrifugation) we can deduce that Cest-2923 behaves in solution as an associative system well described by two equilibria, namely, a fast equilibrium between species with molecular masses consistent with monomers and dimers and another, much faster one between dimeric and tetrameric species, and secondly that the crystallization process is an active player in selecting a preexisting oligomeric form: dimers at neutral conditions, tetramers at acidic ones. f9us10-1 1446159 n/a Cest-2923 1446160 unspecified role unspecified role neutral component neutral component purified purified tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false f5 sf3 Combining the results derived from these two distinct experimental approaches (crystallographic and analytical ultracentrifugation) we can deduce that Cest-2923 behaves in solution as an associative system well described by two equilibria, namely, a fast equilibrium between species with molecular masses consistent with monomers and dimers and another, much faster one between dimeric and tetrameric species, and secondly that the crystallization process is an active player in selecting a preexisting oligomeric form: dimers at neutral conditions, tetramers at acidic ones.