MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2013w-1 Prolyl isomerase Pin1 enhances osteoblast differentiation through Runx2 regulation human-293a Homo sapiens hek293a hek293a anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lee S.H., Choi Y.H., Kim Y.J., Choi H.S., Yeo C.Y., Lee K.Y. kwanglee@chonnam.ac.kr FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation anonymous-2013w-2 Prolyl isomerase Pin1 enhances osteoblast differentiation through Runx2 regulation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lee S.H., Choi Y.H., Kim Y.J., Choi H.S., Yeo C.Y., Lee K.Y. kwanglee@chonnam.ac.kr FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation anonymous-2013w-3 Prolyl isomerase Pin1 enhances osteoblast differentiation through Runx2 regulation human-293a Homo sapiens hek293a hek293a anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lee S.H., Choi Y.H., Kim Y.J., Choi H.S., Yeo C.Y., Lee K.Y. kwanglee@chonnam.ac.kr FEBS Lett. (0014-5793) 2013 Only protein-protein interactions imex curation pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE runx2_human Runt-related transcription factor 2 Oncogene AML-3 Polyomavirus enhancer-binding protein 2 alpha A subunit SL3-3 enhancer factor 1 alpha A subunit SL3/AKV core-binding factor alpha A subunit Osteoblast-specific transcription factor 2 Core-binding factor subunit alpha-1 Acute myeloid leukemia 3 protein RUNX2 AML3 CBFA1 OSF2 PEBP2A protein protein human Homo sapiens Human MASNSLFSTVTPCQQNFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQQEAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY pin1-runx2 1443115 n/a Pin1 1443118 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tag xpress tag xpress tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a Runx2 1443119 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2a pin1-runx2-1 1443115 n/a Runx2 1443119 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a Pin1 1443118 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f2b pin1-runx2-3 1443115 n/a Runx2 1443119 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a Pin1 1443118 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tag xpress tag xpress tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2d . Lysates of Runx2 transfected cells were incubated with or without calf intestinal alkaline phosphatase (CIP) and subjected to immunoprecipitation. Dephosphorylation of Runx2 abolished the binding between Runx2 and Pin1 (Fig. 2D). These results indicate that Pin1 interacts with Runx2 in Runx2 phosphorylation-dependent manner. pin1-runx2-2 1443116 n/a Runx2 1443119 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey cell lysate cell lysate binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a Pin1 1443118 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q13526:p.Tyr24Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f3b f3d We tested Ser or Tyr residue (including Ser16) substitution mutants of Pin1 (Fig. 3A) for the interaction with Runx2. Substitution of Ser16 to Ala abolished the binding of Pin1 to Runx2 (Fig. 3C). Tyr to Ala substitution (Y23A or Y24A) in the WW domain also significantly reduced the interaction with Runx2, whereas same substitution in the PPIase catalytic domain (Y94A) did not have any noticeable effect (Fig. 3D). Collectively, these results suggest that the WW domain of Pin1 is important for binding to Runx2 pin1-runx2-4 1443116 n/a Runx2 1443119 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey cell lysate cell lysate binding site binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false n/a Pin1 1443118 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role bait bait purified purified tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2c pin1-runx2-7 1443116 n/a Pin1 1443118 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q13526:p.Tyr23Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a Runx2 1443119 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey cell lysate cell lysate binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3b f3d We tested Ser or Tyr residue (including Ser16) substitution mutants of Pin1 (Fig. 3A) for the interaction with Runx2. Substitution of Ser16 to Ala abolished the binding of Pin1 to Runx2 (Fig. 3C). Tyr to Ala substitution (Y23A or Y24A) in the WW domain also significantly reduced the interaction with Runx2, whereas same substitution in the PPIase catalytic domain (Y94A) did not have any noticeable effect (Fig. 3D). Collectively, these results suggest that the WW domain of Pin1 is important for binding to Runx2 pin1-runx2-6 1443117 n/a Runx2 1443119 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a Pin1 1443118 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tag xpress tag xpress tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q13526:p.Ser16Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f3c . Lysates of Runx2 transfected cells were incubated with or without calf intestinal alkaline phosphatase (CIP) and subjected to immunoprecipitation. Dephosphorylation of Runx2 abolished the binding between Runx2 and Pin1 (Fig. 2D). These results indicate that Pin1 interacts with Runx2 in Runx2 phosphorylation-dependent manner.