MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint barakat-2013-2 Interaction of smoothened with integrin-linked kinase in primary cilia mediates Hedgehog signalling. mouse-imcd3 Mouse inner medullary collecting duct (mIMCD3) cells imcd3 Immortalized inner medullary collecting duct cells immortalized cells from the inner medullary collecting duct cells bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Barakat B., Yu L., Lo C., Vu D., De Luca E., Cain J.E., Martellotto L.G., Dedhar S., Sadler A.J., Wang D., Watkins D.N., Hannigan G.E. greg.hannigan@monash.edu EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation barakat-2013-1 Interaction of smoothened with integrin-linked kinase in primary cilia mediates Hedgehog signalling. mouse-c3h10t1_2 Mouse embryonic fibroblast C3H10T1_2 c3h10t1_2 Mouse mesenchymal stem cells bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Barakat B., Yu L., Lo C., Vu D., De Luca E., Cain J.E., Martellotto L.G., Dedhar S., Sadler A.J., Wang D., Watkins D.N., Hannigan G.E. greg.hannigan@monash.edu EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation parva_human Alpha-parvin Calponin-like integrin-linked kinase-binding protein CH-ILKBP Matrix-remodeling-associated protein 2 Actopaxin PARVA MXRA2 protein protein human Homo sapiens Human MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE ilk_human Integrin-linked protein kinase ILK-1 ILK-2 59 kDa serine/threonine-protein kinase p59ILK ILK ILK1 ILK2 Beta-integrin-linked kinase protein protein human Homo sapiens Human MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK lims1_human LIM and senescent cell antigen-like-containing domain protein 1 LIMS1 Particularly interesting new Cys-His protein 1 Renal carcinoma antigen NY-REN-48 PINCH PINCH1 protein protein human Homo sapiens Human MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETLGRK smo_human Smoothened homolog Protein Gx SMO SMOH protein protein human Homo sapiens Human MAAARPARGPELPLLGLLLLLLLGDPGRGAASSGNATGPGPRSAGGSARRSAAVTGPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGCTNEVQNIKFNSSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF arrb1_human Beta-arrestin-1 Arrestin beta-1 ARRB1 ARR1 Non-visual arrestin-2 protein protein human Homo sapiens Human MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR arrb2_human Beta-arrestin-2 Arrestin beta-2 ARRB2 ARB2 ARR2 Non-visual arrestin-3 protein protein human Homo sapiens Human MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC kif3a_human Kinesin-like protein KIF3A KIF3A KIF3 Microtubule plus end-directed kinesin motor 3A protein protein human Homo sapiens Human MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSSNEPPKTFTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGIDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLEEGEEISGSDISGSEEDDDEEGEVGEDGEKRKKRRGKKKVSPDKMIEMQAKIDEERKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSLLQ ilk-parva-5 1459561 n/a 1459563 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459564 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q13418:p.[Met402Ala;Lys403Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false sf4a sf4c ilk-lims1-4 1459561 n/a 1459565 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459564 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q13418:p.[Met402Ala;Lys403Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false sf4b sf4d ilk-smo 1459561 n/a 1459564 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459566 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3b f3c While ILK and Smo interact in the cilium, ILK-arrB2 (Fig 4A), ILK-arrB1 (supplementary Fig S4G online) and Kif3a-arrB2 (Fig 4B) complexes were observed at the ciliary base in close association with the basal body. ilk-arr2 1459561 n/a 1459564 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459567 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false sf4g arrb2-ilk 1459561 n/a 1459568 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459564 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4a arrb2-kif 1459561 n/a 1459568 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459569 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f4b arrb2-smo 1459561 n/a 1459568 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459566 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3a Using BiFC, we observed interaction of Smo with either arrB2 (Fig 3A) or arrB1 in cilia (supplementary Fig S4F online), in which we also observed Smo interaction with ILK (Fig 3B,C). arrb2-smo-1 1459561 n/a 1459566 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459567 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false sf4f Using BiFC, we observed interaction of Smo with either arrB2 (Fig 3A) or arrB1 in cilia (supplementary Fig S4F online), in which we also observed Smo interaction with ILK (Fig 3B,C). ilk-parva-3 1459562 n/a 1459564 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q13418:p.[Met402Ala;Lys403Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1459563 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false sf3a sf3c ilk-parva-4 1459562 n/a 1459564 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q13418:p.[Met402Ala;Lys403Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1459565 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell venus tag venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false sf3b sf3d