MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ide-2013-2 Protein-protein interactions between intermediate chains and the docking complex of Chlamydomonas flagellar outer arm dynein. in vitro In vitro crosslink cross-linking study crosslink experimental particp experimental participant identification experimental particp Ide T., Owa M., King SM., Kamiya R., Wakabayashi K. FEBS Lett. (0014-5793) 2013 ide-2013-1 Protein-protein interactions between intermediate chains and the docking complex of Chlamydomonas flagellar outer arm dynein. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip experimental particp experimental participant identification experimental particp Ide T., Owa M., King SM., Kamiya R., Wakabayashi K. FEBS Lett. (0014-5793) 2013 dyi2_chlre Dynein, 78 kDa intermediate chain, flagellar outer arm ODA9 ODA-9 IC78 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MPALSPAKKGTDKGKTGKKTGKQEQNAQDYIPPPPPMPGDEAFAMPIREIVKPDNQLWLSEADLNEEVAKMLTANNPAAPKNIVRFNMKDKVFKLEPMVEQTVVHYATDGWLLHKSSDEAKRQMDMEKMEQEASARFQADIDRASHEHKDHGDVEPPDDSRQLRNQFNFSERAAQTLNYPLRDRETFTEPPPTATVSGACTQWEIYDEYIKDLERQRIDEAMKSKGGKKAAAAARAAGAAHRQRNEHVPTLQSPTLMHSLGTLDRMVNQNMYEEVAMDFKYWDDASDAFRPGEGSLLPLWRFVSDKSKRRQVTSVCWNPLYDDMFAVGYGSYEFLKQASGLINIYSLKNPSHPEYTFHTESGVMCVHFHPEFANLLAVGCYDGSVLVYDVRLKKDEPIYQASVRTGKLNDPVWQIYWQPDDAQKSLQFVSISSDGAVNLWTLTKSELIPECLMKLRVVRAGETREEEDPNASGAAGGCCMDFCKMPGQESIYLVGTEEGAIHRCSKAYSSQYLSTYVSHHLAVYAVHWNNIHPSMFLSASCRLDHQAVGLCHDPKRAVMNFDLNDSIGDVSWAALQPTVFAAVTDDGRVHVFDLAQNKLLPLCSQKVVKKAKLTKLVFNPKHPIVLVGDDKGCVTSLKLSPNLRITSKPEKGQKFEDLEVAKLDGVVEIARKSDADLAKNAAH mint dyi3_chlre Dynein, 70 kDa intermediate chain, flagellar outer arm ODA6 IC70 ODA-6 IC69 IC70 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MEIYHQYIKLRKQFGRFPKFGDEGSEMLADIRPNEDHGKEYIPRNPVTTVTQCVPEMSEHEANTNAVILVNKAMSHVEGGWPKDVDYTEAEHTIRYRKKVEKDEDYIRTVVQLGSSVEDLIKQNNAVDIYQEYFTNVTMDHTSEAPHVKTVTVFKDPNNIKRSASYVNWHPDGSVPKVVVAYSILQFQQQPAGMPLSSYIWDVNNPNTPEYEMVPTSQICCAKFNLKDNNLVGAGQYNGQLAYFDVRKGNGPVEATPIDISHRDPIYDFAWLQSKTGTECMTVSTDGNVLWWDLRKMNECVENMPLKEKNSETTVGGVCLEYDTNAGPTNFMVGTEQGQIFSCNRKAKNPVDRVKYVLSGHHGPIYGLRRNPFNSKYFLSIGDWTARVWVEDTAVKTPILTTKYHPTYLTGGTWSPSRPGVFFTIKMDGAMDVWDLYYKHNEPTLTVQVSDLALTAFAVQESGGTVAVGTSDGCTSVLQLSTGLSEASPAEKANINAMFERETTREKNLEKAIKEAKVKARKEQGRRDEVKDNVTEEQLKALEDEFFKTTDPAVGGGYGAGEGAAAE a8ipz5_chlre CHLRE_17g703850v5 ODA3 CHLREDRAFT_189083 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MAQKSTLKLPRLRTKEELLKTSPELCKLLGEDSDDGRSMSPFTAPPPAGTVKPPSRGLPAVSTKATKGPGMDTPRGLGEEELTEEELLRLELEKIKNERQVLLDSIKLVKAQAGTAGGEAQQNDIKALRRELELKKAKLNELHEDVRRKENVLNKQRDDTTDASRLTPGELSEEQAYIQQLQDEMKQIDEELVEAEAKNRLYYLLGERTRREHLAMDMKVRASQQLKKDSADDLYTLTAHFNEMRAAKEQAERELARMKRMLEETRVDWQKKLRERRREVRELKKRQQKQLERERKMREKQLERERQERELQAKLKMEQDSYEMRVAALAPKVEAMEHSWNRIRTISGADTPEEVLAYWEGLKAKEEQMRSLVSLAEQRESSAKSEIAALLENRSGMYEKGSAAAADVGEGSEERATLITEVERNMEGAKGKFNKLRSVCIGAEQGLRSLQERLMIALEEIHPDQLRASHMKGGHDAKARGKGAASAGARRGSAHAHTPDRNKRGPATGSRSQSPALVPHSPAGDKPSSPLHGTSPEHGHEPIPEGAEELAGEAEMVSPLGADGNTIDDEHFFPELPELLTSVTDRLNRVLVLAAELDAQEPAGAGEDGLPLSGEPGADGAEGAAPASPSRGAPEGLSESERTLVKGMNRRTWTGAPLLETINASPSEAALTLNIKRKKGKKKEQQVQPDLNRILGYTGSDVEEEEPESEEETEEEANKDDGVVDRDYIKLRALKMSQRLANQQRAIKV mint oda1_chlre Outer dynein arm protein 1 ODA1 DCC2 Docking complex component 2 CHLREDRAFT_132719 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MPSADATRGGGSAGSMGKGTLGAGDTLGHKSVLDKQRAAIEKLRAQNEQLKTELLLENKFSVRPGDPFAQALINRLQDEGDMLARKIVLEMRKTKMLDQQLSEMGSTLTTTRNNMGGIFSAKEQSTAVQKRIKLLENRLEKAYVKYNQSITHNKQLRESINNLRRERIMFESIQSNLERELAKLKRDMADMIQQANGAFEAREKAIGEMNALKAQADKEQQGFEEEWRQLTTIIEEDKKERERARAQELAMRERETQELLKMGTLSSAEKKKRITKGSWNVGYNKAMAQNVAAEKVEMYGQAFKRIQDATGIEDIDQLVNTFLAAEDQNYTLFNYVNEVNQEIEKLEDQINIMRGEINKYRETGRELDMTKSRELTEEEARLAASEAQSQLYEKRTDSALSMTTALKAGINDLFERIGCNTPAVRDLLGEEGVTEANLTAYLGIIEQRTNEILQIYAKRKAQQGTDGLAEALLAQPLTQPGNRIIIEPPSTTQEEEVEGLEPEPVEEDRPLTREHLESKVQRTLPRKLETAIKVRPAGADATGGKRGSPTRR mint oda6-oda9-1 1391341 dyi2_chlre IC1 1391343 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dyi3_chlre IC2 1391344 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3c mint oda3-oda9 1391341 dyi2_chlre IC1 1391343 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false a8ipz5_chlre DC1 1391345 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3c mint oda1-oda3 1391341 a8ipz5_chlre DC1 1391345 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a DC2 1391346 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dyi2_chlre IC1 1391343 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3c mint oda1-oda3-1 1391341 a8ipz5_chlre DC1 1391345 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false oda1_chlre DC2 1391346 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dyi3_chlre IC2 1391344 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3c mint oda1-oda3-2 1391341 a8ipz5_chlre DC1 1391345 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false oda1_chlre DC2 1391346 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3c mint oda3-oda6 1391341 a8ipz5_chlre DC1 1391345 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dyi3_chlre IC2 1391344 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3c mint oda6-oda9 1391342 n/a IC1 1391343 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a IC2 1391344 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false f3a mint oda1-oda6 1391342 dyi2_chlre IC1 1391343 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a DC2 1391346 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dyi3_chlre IC2 1391344 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint f3B oda6-oda1-2 1391342 n/a DC2 1391346 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a DC1 1391345 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a IC2 1391344 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3B mint