MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kuijpers-2013-5 The ALS8 protein VAPB interacts with the ER-Golgi recycling protein YIF1A and regulates membrane delivery into dendrites. rat-neuron Rattus norvegicus neuronal cell neuron Neuron [Neuronal cell; Neural cell fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kuijpers M., Yu K.L., Teuling E., Akhmanova A., Jaarsma D., Hoogenraad C.C. c.hoogenraad@uu.nl EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation kuijpers-2013-3 The ALS8 protein VAPB interacts with the ER-Golgi recycling protein YIF1A and regulates membrane delivery into dendrites. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kuijpers M., Yu K.L., Teuling E., Akhmanova A., Jaarsma D., Hoogenraad C.C. c.hoogenraad@uu.nl EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation kuijpers-2013-2 The ALS8 protein VAPB interacts with the ER-Golgi recycling protein YIF1A and regulates membrane delivery into dendrites. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Kuijpers M., Yu K.L., Teuling E., Akhmanova A., Jaarsma D., Hoogenraad C.C. c.hoogenraad@uu.nl EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation kuijpers-2013-4 The ALS8 protein VAPB interacts with the ER-Golgi recycling protein YIF1A and regulates membrane delivery into dendrites. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kuijpers M., Yu K.L., Teuling E., Akhmanova A., Jaarsma D., Hoogenraad C.C. c.hoogenraad@uu.nl EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation kuijpers-2013-1 The ALS8 protein VAPB interacts with the ER-Golgi recycling protein YIF1A and regulates membrane delivery into dendrites. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Kuijpers M., Yu K.L., Teuling E., Akhmanova A., Jaarsma D., Hoogenraad C.C. c.hoogenraad@uu.nl EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation vapb_rat Vesicle-associated membrane protein-associated protein B Vapb protein protein rat Rattus norvegicus (Rat) Rat MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGVIDAGASLNVSVMLQPFDYDPNEKSKHKFMVQSMFAPPDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENAKPHDVEINKIMPTSASKTEAPVAAKPLTSPLDDAEVKKVMEECRRLQGEVQRLREESRQLKEEDGLRARKALPSNSPMAALAASGKEEGLSARLLALVVLFFIVGVIIGKIAL mint May play a role in vesicle trafficking yif1a_human Protein YIF1A 54TM HYIF1P YIF1 54TMp YIP1-interacting factor homolog A YIF1A protein protein human Homo sapiens Human MAYHSGYGAHGSKHRARAAPDPPPLFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMANVAMAYGSSIASHGKDMVHKELHRFVSVSKLKYFFAVDTAYVAKKLGLLVFPYTHQNWEVQYSRDAPLPPRQDLNAPDLYIPTMAFITYVLLAGMALGIQKRFSPEVLGLCASTALVWVVMEVLALLLGLYLATVRSDLSTFHLLAYSGYKYVGMILSVLTGLLFGSDGYYVALAWTSSALMYFIVRSLRTAALGPDSMGGPVPRQRLQLYLTLGAAAFQPLIIYWLTFHLVR lman1_rat Protein ERGIC-53 ER-Golgi intermediate compartment 53 kDa protein Lectin mannose-binding 1 p58 Lman1 Ergic53 protein protein rat Rattus norvegicus (Rat) Rat MAVSRRRGPQAGAQSFFCALLLSFSQFVGSDGMGGDAAAPGAAGTQAELPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSADQIRIAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYTENQGLDGPVFGSADMWNGVGIFFDSFDNDGKKNNPAIVVVGNNGQINYDHQNDGATQALASCQRDFRNKPYPVRAKITYYQKTLTVMINNGFTPDKNDYEFCAKVENMVIPTQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPEKDISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPADDIFESIGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISRRGAGTPGQPGQVSQQELDTVVRTQLEILRQVNEMKNSMRETMRLVSGVQHPGSAGVYETTQHFMDIKEHLHIVKRDIDSLAQRSMSSNEKPKCPDLPAFPSCLSTVHFVIFIVVQTVLFIGYIMYRTQQEAAAKKFF goga2_rat Golgin subfamily A member 2 Golga2 130 kDa cis-Golgi matrix protein protein protein rat Rattus norvegicus (Rat) Rat MWPPRFPPPRPGMSEETRQSKLAAAKKKLREYQQKNSPGVPAGAKKKKKIKNGHSPERTSASDCQSAENVPTDHTAPAPPSTAAATMFLGVVPSPDADLIQSHDAGNCSNLMEETKTFSSTESLRQLSQQLNGLVSESTSYINGEGLTSSNMKELESRYQELAVALDSSYVTNKQLSSTIEELKQQNQDTLDQLEKEKKDYQQKLAKEQGALREQLQVHIQTIGILVSEKAELQTALAHTQQAARQKAGESEDLASRLQSSRQRVGELERTLSTVSTQQKQADRYNKDLTKERDALKLELYKNGKSNEDLRQQNSELEEKLRVLVAEKAAAQLGAEELQKKLEMSELLLQQFSSQSEASGSNEQLQQAMEERAQLESHVGQLMESLKQLQVERDQYAENLKGESAMWQQRVQQMAEQVHALKEEKEQRESQVQELEASLAELRSQMEEPPPPEPPTGPSEAEERLQGEVEQLQKELEGLTGQLRAQVQDNESLSHLNREQEGRLLELEREAQHWSEQAEERKQILESMQSDRTTISRALSQNRELKEQLAELQNGFVRLTNENMEITSALQSEQHVKKELARKLGELQERLGELKETVELKSQEAQGLQEQRDQCLSHLQQYAAAYQQHLTAYEQLTSEKEALHKQLLLQTQLMDQLQHEEVQGKMAAEMARQELQEAQERLKASSQENQQLQAQLSLLVLPGEDMDQEEQDEEVPQPSLTIPEDLVSREAMVAFCNAAIARAEEEQARLRVQLREQKARCRSLAHLAAPVQSKLEKEAVVPRDMGDSVSEESNQALHVAMEKLQNRFLEVMQEKVELKERVEELEHCCIQLSGETDTIGEYIALYQNQRAVLKARHLEKEEYISRLAQDKEEMKVKLLELQELVLRLVNERNEWQGKFLAVSQNPADVPAPVPTGSQEFGAADQQGDLREVSLADDTEPAQGEAGVPAPQENPTAQQIMQLLREIQNPQERPGLGSNPCIPFFYRADENDEVKIMVI vapb_human Vesicle-associated membrane protein-associated protein B/C VAPB UNQ484/PRO983 protein protein human Homo sapiens Human MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL yipf5_human Protein YIPF5 YIPF5 FINGER5 YIP1A YIP1 family member 5 YPT-interacting protein 1 A Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 5 Smooth muscle cell-associated protein 5 PP12723 SB140 UNQ3123/PRO10275 protein protein human Homo sapiens Human MSGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQPYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPLKVADGSIMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTGVSFGCVASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISALAMEGQQLLVAYPCALLYGVFALISVF yif1b_rat Protein YIF1B Yif1b YIP1-interacting factor homolog B protein protein rat Rattus norvegicus (Rat) Rat MHATGLAAPAGTPRLRKWPSKRRVPVSQPGMADPHQFFDDTSSAPSRGYGGQPSPGSLGYPTSSSEAAFLAAPMSNMAMAYGSSLAAQGKELVDKNIDRFIPVSKLKYYFAVDTVYVGKKLGLLVFPYLHQDWEVQYQQDTPVAPRFDINAPDLYIPAMAFITYILVAGLALGTQDRMIGGVLTGLLFGKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAAAEGVPVRGARNQLRMYLTMAVAAAQPVLMYWLTFHLVR vapa_human Vesicle-associated membrane protein-associated protein A VAPA VAP33 33 kDa VAMP-associated protein protein protein human Homo sapiens Human MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL pitm1_human Membrane-associated phosphatidylinositol transfer protein 1 PITPNM1 DRES9 NIR2 PITPNM Drosophila retinal degeneration B homolog Phosphatidylinositol transfer protein, membrane-associated 1 Pyk2 N-terminal domain-interacting receptor 2 protein protein human Homo sapiens Human MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGPGGSGQYTHKVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCPFVEKFSIEIETYYLPDGGQQPNVFNLSGAERRQRILDTIDIVRDAVAPGEYKAEEDPRLYHSVKTGRGPLSDDWARTAAQTGPLMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRAHRQAWCWQDEWTELSMADIRALEEETARMLAQRMAKCNTGSEGSEAQPPGKPSTEARSAASNTGTPDGPEAPPGPDASPDASFGKQWSSSSRSSYSSQHGGAVSPQSLSEWRMQNIARDSENSSEEEFFDAHEGFSDSEEVFPKEMTKWNSNDFIDAFASPVEAEGTPEPGAEAAKGIEDGAQAPRDSEGLDGAGELGAEACAVHALFLILHSGNILDSGPGDANSKQADVQTLSSAFEAVTRIHFPEALGHVALRLVPCPPICAAAYALVSNLSPYSHDGDSLSRSQDHIPLAALPLLATSSSRYQGAVATVIARTNQAYSAFLRSPEGAGFCGQVALIGDGVGGILGFDALCHSANAGTGSRGSSRRGSMNNELLSPEFGPVRDPLADGVEGLGRGSPEPSALPPQRIPSDMASPEPEGSQNSLQAAPATTSSWEPRRASTAFCPPAASSEAPDGPSSTARLDFKVSGFFLFGSPLGLVLALRKTVMPALEAAQMRPACEQIYNLFHAADPCASRLEPLLAPKFQAIAPLTVPRYQKFPLGDGSSLLLADTLQTHSSLFLEELEMLVPSTPTSTSGAFWKGSELATDPPAQPAAPSTTSEVVKILERWWGTKRIDYSLYCPEALTAFPTVTLPHLFHASYWESADVVAFILRQVIEKERPQLAECEEPSIYSPAFPREKWQRKRTQVKIRNVTSNHRASDTVVCEGRPQVLSGRFMYGPLDVVTLTGEKVDVYIMTQPLSGKWIHFGTEVTNSSGRLTFPVPPERALGIGVYPVRMVVRGDHTYAECCLTVVARGTEAVVFSIDGSFTASVSIMGSDPKVRAGAVDVVRHWQDSGYLIVYVTGRPDMQKHRVVAWLSQHNFPHGVVSFCDGLTHDPLRQKAMFLQSLVQEVELNIVAGYGSPKDVAVYAALGLSPSQTYIVGRAVRKLQAQCQFLSDGYVAHLGQLEAGSHSHASSGPPRAALGKSSYGVAAPVDFLRKQSQLLRSRGPSQAEREGPGTPPTTLARGKARSISLKLDSEE osbl3_human Oxysterol-binding protein-related protein 3 OSBPL3 KIAA0704 ORP3 OSBP3 protein protein human Homo sapiens Human MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLKKRKWPLKGWHKRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEEVFDEWVSKLRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINAIQGGSFESPKKEKRSHRRWRSRAIGKDAKGTLQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNLAEENSRDENRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENEISDDDSYVSDISDNLSLDNLSNDLDNERQTLGPVLDSGREAKSRRRTCLPAPCPSSSNISLWNILRNNIGKDLSKVAMPVELNEPLNTLQRLCEELEYSELLDKAAQIPSPLERMVYVAAFAISAYASSYYRAGSKPFNPVLGETYECIREDKGFQFFSEQVSHHPPISACHAESRNFVFWQDVRWKNKFWGKSMEIVPIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWIEHYGEIVIKNLHDDSCYCKVNFIKAKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGGSSSACVWRANPMPKGYEQYYSFTQFALELNEMDPSSKSLLPPTDTRFRPDQRFLEEGNLEEAEIQKQRIEQLQRERRRVLEENHVEHQPRFFRKSDDDSWVSNGTYLELRKDLGFSKLDHPVLW osbl6_human Oxysterol-binding protein-related protein 6 OSBPL6 ORP6 protein protein human Homo sapiens Human MSSDEKGISPAHKTSTPTHRSASSSTSSQRDSRQSIHILERTASSSTEPSVSRQLLEPEPVPLSKEADSWEIIEGLKIGQTNVQKPDKHEGFMLKKRKWPLKGWHKRFFVLDNGMLKYSKAPLDIQKGKVHGSIDVGLSVMSIKKKARRIDLDTEEHIYHLKVKSQDWFDAWVSKLRHHRLYRQNEIVRSPRDASFHIFPSTSTAESSPAANVSVMDGKMQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVELSKLLQNLEILQRTQSAPNFTDMQANCVDISKKDKRVTRRWRTKSVSKDTKIQLQVPFSATMSPVRLHSSNPNLCADIEFQTPPSHLTDPLESSTDYTKLQEEFCLIAQKVHSLLKSAFNSIAIEKEKLKQMVSEQDHSKGHSTQMARLRQSLSQALNQNAELRSRLNRIHSESIICDQVVSVNIIPSPDEAGEQIHVSLPLSQQVANESRLSMSESVSEFFDAQEVLLSASSSENEASDDESYISDVSDNISEDNTSVADNISRQILNGELTGGAFRNGRRACLPAPCPDTSNINLWNILRNNIGKDLSKVSMPVELNEPLNTLQHLCEEMEYSELLDKASETDDPYERMVLVAAFAVSGYCSTYFRAGSKPFNPVLGETYECIREDKGFRFFSEQVSHHPPISACHCESKNFVFWQDIRWKNKFWGKSMEILPVGTLNVMLPKYGDYYVWNKVTTCIHNILSGRRWIEHYGEVTIRNTKSSVCICKLTFVKVNYWNSNMNEVQGVVIDQEGKAVYRLFGKWHEGLYCGVAPSAKCIWRPGSMPTNYELYYGFTRFAIELNELDPVLKDLLPPTDARFRPDQRFLEEGNLEAAASEKQRVEELQRSRRRYMEENNLEHIPKFFKKVIDANQREAWVSNDTYWELRKDPGFSKVDSPVLW osbl9_human Oxysterol-binding protein-related protein 9 OSBPL9 ORP9 OSBP4 protein protein human Homo sapiens Human MASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKDKMMRGSRRGCVRLRGAVIGIDDEDDSTFTITVDQKTFHFQARDADEREKWIHALEETILRHTLQLQGLDSGFVPSVQDFDKKLTEADAYLQILIEQLKLFDDKLQNCKEDEQRKKIETLKETTNSMVESIKHCIVLLQIAKDQSNAEKHADGMISTINPVDAIYQPSPLEPVISTMPSQTVLPPEPVQLCKSEQRPSSLPVGPVLATLGHHQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADEFHQSGSSPKRLIDSSGSASVLTHSSSGNSLKRPDTTESLNSSLSNGTSDADLFDSHDDRDDDAEAGSVEEHKSVIMHLLSQVRLGMDLTKVVLPTFILERRSLLEMYADFFAHPDLFVSISDQKDPKDRMVQVVKWYLSAFHAGRKGSVAKKPYNPILGEIFQCHWTLPNDTEENTELVSEGPVPWVSKNSVTFVAEQVSHHPPISAFYAECFNKKIQFNAHIWTKSKFLGMSIGVHNIGQGCVSCLDYDEHYILTFPNGYGRSILTVPWVELGGECNINCSKTGYSANIIFHTKPFYGGKKHRITAEIFSPNDKKSFCSIEGEWNGVMYAKYATGENTVFVDTKKLPIIKKKVRKLEDQNEYESRSLWKDVTFNLKIRDIDAATEAKHRLEERQRAEARERKEKEIQWETRLFHEDGECWVYDEPLLKRLGAAKH vapb-yif1a-6 1448437 n/a 1448442 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell n/a 1448443 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f3b ergic-yif1a-7 1448437 n/a 1448444 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell n/a 1448443 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f3d f4c f4d gm130-yif1a 1448437 n/a 1448443 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448445 immunostaining immunostaining unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f4a f4b vapb-yif1a-7 1448437 n/a 1448443 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448446 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f9a lman1-vapb 1448437 n/a 1448446 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448443 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448444 unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f6b f9c f9d lman1-vapb-1 1448437 n/a 1448447 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448444 unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell n/a 1448443 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f6c lman1-yif1a 1448437 n/a 1448447 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448443 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f9e lman1-vapb-2 1448437 n/a 1448443 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448446 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f9f vapb-yif1a-8 1448437 n/a 1448447 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448446 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448443 unspecified role unspecified role unspecified role unspecified role fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f9g vapb-yif1a-2 1448438 n/a 1448443 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448446 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f1e f1f To further confirm the interaction between VAPB and YIF1A, we performed immunofluorescence experiments in COS-7 cells. HA-YIF1A co-localized with both endogenous VAPB and co-transfected myc-VAPB, which as previously demonstrated localize to the ER (Nishimura et al, 2004; Kanekura et al, 2006; Teuling et al, 2007; Kim et al, 2010; Papiani et al, 2012) (Figure 1D and E). Significantly, HA-YIF1A also co-distributes with ALS-linked mutant VAPB-P56S and VAPA-P56S (Figure 1F and H), which accumulates in small spherical inclusions (Nishimura et al, 2004; Kanekura et al, 2006; Teuling et al, 2007; Kim et al, 2010; Papiani et al, 2012). Likewise also YIF1B was recruited to mutant VAPA/B inclusion (Figure 1G and I). Together, these results show that YIF1A/B interacts with VAPA/B family proteins. vapb-yif1b-3 1448438 n/a 1448448 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448446 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f1g To further confirm the interaction between VAPB and YIF1A, we performed immunofluorescence experiments in COS-7 cells. HA-YIF1A co-localized with both endogenous VAPB and co-transfected myc-VAPB, which as previously demonstrated localize to the ER (Nishimura et al, 2004; Kanekura et al, 2006; Teuling et al, 2007; Kim et al, 2010; Papiani et al, 2012) (Figure 1D and E). Significantly, HA-YIF1A also co-distributes with ALS-linked mutant VAPB-P56S and VAPA-P56S (Figure 1F and H), which accumulates in small spherical inclusions (Nishimura et al, 2004; Kanekura et al, 2006; Teuling et al, 2007; Kim et al, 2010; Papiani et al, 2012). Likewise also YIF1B was recruited to mutant VAPA/B inclusion (Figure 1G and I). Together, these results show that YIF1A/B interacts with VAPA/B family proteins. vapa-yif1b-3 1448438 n/a 1448448 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448449 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f1i To further confirm the interaction between VAPB and YIF1A, we performed immunofluorescence experiments in COS-7 cells. HA-YIF1A co-localized with both endogenous VAPB and co-transfected myc-VAPB, which as previously demonstrated localize to the ER (Nishimura et al, 2004; Kanekura et al, 2006; Teuling et al, 2007; Kim et al, 2010; Papiani et al, 2012) (Figure 1D and E). Significantly, HA-YIF1A also co-distributes with ALS-linked mutant VAPB-P56S and VAPA-P56S (Figure 1F and H), which accumulates in small spherical inclusions (Nishimura et al, 2004; Kanekura et al, 2006; Teuling et al, 2007; Kim et al, 2010; Papiani et al, 2012). Likewise also YIF1B was recruited to mutant VAPA/B inclusion (Figure 1G and I). Together, these results show that YIF1A/B interacts with VAPA/B family proteins. vapa-yif1b-4 1448438 n/a 1448443 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448449 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f1h To further confirm the interaction between VAPB and YIF1A, we performed immunofluorescence experiments in COS-7 cells. HA-YIF1A co-localized with both endogenous VAPB and co-transfected myc-VAPB, which as previously demonstrated localize to the ER (Nishimura et al, 2004; Kanekura et al, 2006; Teuling et al, 2007; Kim et al, 2010; Papiani et al, 2012) (Figure 1D and E). Significantly, HA-YIF1A also co-distributes with ALS-linked mutant VAPB-P56S and VAPA-P56S (Figure 1F and H), which accumulates in small spherical inclusions (Nishimura et al, 2004; Kanekura et al, 2006; Teuling et al, 2007; Kim et al, 2010; Papiani et al, 2012). Likewise also YIF1B was recruited to mutant VAPA/B inclusion (Figure 1G and I). Together, these results show that YIF1A/B interacts with VAPA/B family proteins. vapb-yif1a-5 1448438 n/a 1448443 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 1448446 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f2j f2k f2l sf1 GxxxG motifs are known to facilitate interactions between transmembrane helices and mediate the assembly of the transmembrane helices in VAPB (Kim et al, 2010). However, disruption of these motifs in YIF1A did not interfere with VAPB binding (Figure 2I). These data were confirmed by immunofluorescence in COS-7 cells (Figure 2J–L; Supplementary Figure S1). The results show that the first two transmembrane domains of YIF1A are important for VAPB binding but that this binding does not depend on GxxxG motifs. Together, these data indicate that the transmembrane domains of both VAPB and YIF1A are important for their interaction. vapb-yif1a 1448439 n/a 1448443 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448446 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell bio tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1b f2f f2g f2i Pull-down experiments with biotinylated VAPB showed that all transmembrane containing YIF1A constructs co-precipitated with VAPB (Figure 2F). However, VAPB brings down considerable higher amounts of truncated GFP-YIF1A proteins that contain the first and second transmembrane domain (131–198) (Figure 2F), indicating that the VAPB interaction is strongest with this region. The marked difference between binding of the first two transmembrane domains compared to the last two transmembrane domains suggests a specific interaction between YIF1A and VAPB. GFP-YIF1A (131–198) also efficiently co-precipitated with VAPB-P56S (Figure 2G). vapa-yif1b-2 1448439 n/a 1448449 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell bio tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448448 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1c vapb-yif1a-1 1448439 n/a 1448446 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bio tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448448 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1b vapa-vapa 1448439 n/a 1448443 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448449 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bio tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1c yif1a-vapb 1448440 n/a 1448443 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 1448446 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2c f2d vapb-yif1a-4 1448440 n/a 1448443 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448446 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f2h osbpl3-osbpl6 1448441 n/a 1448450 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell n/a 1448443 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell n/a 1448446 predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell bio-gfp tag tandem tag tandem tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1448451 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell n/a 1448452 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell n/a 1448453 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell association association false false false f1a