IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ji-2013-1 SR proteins collaborate with 7SK and promoter-associated nascent RNA to release paused polymerase. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ji X., Zhou Y., Pandit S., Huang J., Li H., Lin C.Y., Xiao R., Burge C.B., Fu X.D. Formaldehde was used as cross-linking agent except in the case of Hexim1 and Cdk9 which were identified binding to gene loci following glutaraldehyde treatment. xdfu@ucsd.edu Cell (0092-8674) 2013 Only protein-protein interactions imex curation ji-2013-4 SR proteins collaborate with 7SK and promoter-associated nascent RNA to release paused polymerase. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ji X., Zhou Y., Pandit S., Huang J., Li H., Lin C.Y., Xiao R., Burge C.B., Fu X.D. Formaldehde was used as cross-linking agent except in the case of Hexim1 and Cdk9 which were identified binding to gene loci following glutaraldehyde treatment. xdfu@ucsd.edu Cell (0092-8674) 2013 Only protein-protein interactions imex curation ji-2013-3 SR proteins collaborate with 7SK and promoter-associated nascent RNA to release paused polymerase. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ji X., Zhou Y., Pandit S., Huang J., Li H., Lin C.Y., Xiao R., Burge C.B., Fu X.D. Formaldehde was used as cross-linking agent except in the case of Hexim1 and Cdk9 which were identified binding to gene loci following glutaraldehyde treatment. xdfu@ucsd.edu Cell (0092-8674) 2013 Only protein-protein interactions imex curation ji-2013-2 SR proteins collaborate with 7SK and promoter-associated nascent RNA to release paused polymerase. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ji X., Zhou Y., Pandit S., Huang J., Li H., Lin C.Y., Xiao R., Burge C.B., Fu X.D. Formaldehde was used as cross-linking agent except in the case of Hexim1 and Cdk9 which were identified binding to gene loci following glutaraldehyde treatment. xdfu@ucsd.edu Cell (0092-8674) 2013 Only protein-protein interactions imex curation srsf1_mouse Serine/arginine-rich splicing factor 1 Sfrs1 Splicing factor, arginine/serine-rich 1 Srsf1 ASF/SF2 Pre-mRNA-splicing factor SRp30a protein protein mouse Mus musculus Mouse MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT aurka_mouse_gene Aurora kinase A Serine/threonine-protein kinase Ayk1 Serine/threonine-protein kinase aurora-A Aurka Aik Airk Ark1 Aura Ayk1 Btak Iak1 Stk15 Stk6 Aurora 2 Aurora family kinase 1 Aurora/IPL1-related kinase 1 Ipl1- and aurora-related kinase 1 Serine/threonine-protein kinase 6 gene gene mouse Mus musculus Mouse tyb4_mouse_gene Thymosin beta-4 Tmsb4x Ptmb4 Tmsb4 gene gene mouse Mus musculus Mouse srsf2_mouse Serine/arginine-rich splicing factor 2 Sfrs2 Splicing factor, arginine/serine-rich 2 Srsf2 Pr264 Sfrs10 Splicing factor SC35 Splicing component, 35 kDa Protein PR264 Putative myelin regulatory factor 1 protein protein mouse Mus musculus Mouse MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSRSPRRRRRSRSRSRSRSRSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSPPPVSKRESKSRSRSKSPPKSPEEEGAVSS srsf1_mouse_gene Serine/arginine-rich splicing factor 1 Srsf1 Sfrs1 ASF/SF2 Pre-mRNA-splicing factor SRp30a Splicing factor, arginine/serine-rich 1 gene gene mouse Mus musculus Mouse aurkb_mouse_gene Aurora kinase B Aurkb Aik2 Aim1 Airk2 Ark2 Stk1 Stk12 Stk5 Aurora 1 Aurora- and IPL1-like midbody-associated protein 1 Aurora/IPL1-related kinase 2 STK-1 Serine/threonine-protein kinase 12 Serine/threonine-protein kinase 5 Serine/threonine-protein kinase aurora-B gene gene mouse Mus musculus Mouse srsf7_mouse_gene Serine/arginine-rich splicing factor 7 Srsf7 Sfrs7 Splicing factor, arginine/serine-rich 7 gene gene mouse Mus musculus Mouse mgn_mouse_gene Protein mago nashi homolog Magoh gene gene mouse Mus musculus Mouse hnrpl_mouse_gene Heterogeneous nuclear ribonucleoprotein L Hnrnpl Hnrpl gene gene mouse Mus musculus Mouse srsf2_mouse_gene Serine/arginine-rich splicing factor 2 Srsf2 Pr264 Sfrs10 Sfrs2 Protein PR264 Putative myelin regulatory factor 1 Splicing component, 35 kDa Splicing factor SC35 Splicing factor, arginine/serine-rich 2 gene gene mouse Mus musculus Mouse plk1_mouse_gene Serine/threonine-protein kinase PLK1 Plk1 Plk Polo-like kinase 1 Serine/threonine-protein kinase 13 gene gene mouse Mus musculus Mouse vime_mouse_gene Vimentin Vim gene gene mouse Mus musculus Mouse ptpb1_mouse_gene Polypyrimidine tract-binding protein 1 gene gene mouse Mus musculus Mouse srsf6_mouse_gene Serine/arginine-rich splicing factor 6 gene gene mouse Mus musculus Mouse co1a1_mouse_gene Collagen alpha-1(I) chain Col1a1 Cola1 Alpha-1 type I collagen gene gene mouse Mus musculus Mouse hnrh1_mouse_gene Heterogeneous nuclear ribonucleoprotein H Hnrnph1 Hnrph Hnrph1 gene gene mouse Mus musculus Mouse rir2_mouse_gene Ribonucleoside-diphosphate reductase subunit M2 Rrm2 Ribonucleotide reductase small chain Ribonucleotide reductase small subunit gene gene mouse Mus musculus Mouse rsrc2_mouse_gene Arginine/serine-rich coiled-coil protein 2 Rsrc2 gene gene mouse Mus musculus Mouse hexi1_mouse Protein HEXIM1 Cardiac lineage protein 1 Clp1 Hexim1 protein protein mouse Mus musculus Mouse MAEPLLTEHQHQPQTSNCTGAAVVHEEHTSERPPSAEERVPKEDSRWQSRASLQSGSRPGQEGEGGLKHQLPPLQTNACPELSSLEKGEKGQNGEDLSTGGASPSAEGEPMSESLVQPGHDSEATKQEAPAAGGEEPWGQQQRQLGKKKHRRRPSKKKRHWKPYYKLTWEEKKKFDEKQSLRASRVRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLYPKRAAAKSDDTSDEDFVEEAGEEDGGSDGMGGDGSEFLQRDFSETYERYHAESLQNMSKQELIKEYLELEKCLSRKEDENNRLRLESKRLGGVDARVRELELELDRLRAENLQLLTENELHRQQERAPLSKFGD cdk9_mouse Cyclin-dependent kinase 9 Cdk9 Cell division protein kinase 9 protein protein mouse Mus musculus Mouse MAKQYDSVECPFCDEVTKYEKLAKIGQGTFGEVFKAKHRQTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDKYELFEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF aff4_mouse AF4/FMR2 family member 4 Alf4 Aff4 protein protein mouse Mus musculus Mouse MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYDEMKDYIGDRSIPKLVAIPKPAVPTTTDEKANPNFFEQRHGGSHQSSKWTPVGPAPSTSQSQKRSSALQSGHSSQRSGAGGSGASSSGQRHDRDSYSSSRKKGQHGSEHSKSRSSSPGKPQAVSSLSSSHSRSHGNDHHSKEHQRSKSPRDPDANWDSPSRGPFSSGQHSSQSFPPSLMSKSSSMLQKPTAYVRPMDGQESVEPKLSSEHYSSQSHGNSMTELKPSSKAHLTKLKIPSRPLDASVSGDVSCVDEILKEMTHSWPPPLTAIHTPCKTEPSKFPFPTKESQQSNFGPGEQKRYSTAKTSNGHQSKSMLKDDLKLSSSEDSDGEQDCDKTMPRSTPGSNSEPSHHNSEGADNSRDDSSSHSGSESSSGSDSESESSSSDSEANEPSQSASPEPEPPPTNKWQLDNWLNKVNPHKVSPASSVDSNIPSSQAYKKEGREQGTASNYTDPGGTKETSSATPGRDSKTIQKGSESGRGRQKSPAQSDSTTQRRTVGKKQPKKPEKSAAEEPRGGLKIESETPVDMAASMPSSRHKAATKGSRKPNIKKESKSSPRPTAEKKKYKSASKPSQKSREIIETDTSSSDSDGSESLPPSSQTPKYPESNRTPVKPSSVEEEDSFFRQRMFSPMEEKELLSPLSEPDDRYPLIVKIDLNLLTRIPGKPYKETEPPKGEKKNVPEKHSREVQKQASEKASNKGKRKHKNDDDTRASESKKPKTEDKNSSGHKPSSSRESSKQSSTKEKDLLPSPAGPILSKDSKTEHGSRKRTVSQSSSLKSSGTSSKENSGSSSKSSSSSTAKQKKTEGKGPSSSKEAKEKAPNSSSNCPPSTPTSESSKPRRTKLAFDDRNYSADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALEKNAQESKSPFPMYSDTVELIKYTMKLKNYLAPDATAADKRLTVLCLRCQSLLYLRLFKLKKENALKYSKTLTEHLKNSYSNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGSYSSGGSSASASGSSVTIPQKIHQMAASYVQVTSNFLYATEIWDQAEQLSKEQKEFFAELDKVMGPLIFNASIMTDLARYTRQGLHWLRQDAKLIS brd4_mouse Bromodomain-containing protein 4 Mcap Mitotic chromosome-associated protein Brd4 protein protein mouse Mus musculus Mouse MSTESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRGRGRKETGAAKPGVSTVPNTTQASTSPQTQTPQQNPPPPVQATTHPFPAVTPDLIAQPPVMTMVPPQPLQTPSPVPPQPPPPPAPVPQPVQSHPPIIATTPQPVKTKKGVKRKADTTTPTTIDPIHEPPSLAPEPKTAKLGPRRESSRPVKPPKKDVPDSQQHPGPEKSSKISEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLESREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVTVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKKKEEVEENKKSKTKELPPKKTKKNNSSNSNVSKKEPVPTKTKPPPTYESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESTSESSSSDSEDSETEMAPKSKKKGHTGRDQKKHHHHHHPQMQPAPAPVPQQPPPPPQQPPPPPPPQQQQQQPPPPPPPPSMPQQTAPAMKSSPPPFITAQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPTRPPAVSPALAQPPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQQLQPQPPPPPPPQPQPPPQQQHQPPPRPVHLPSMPFSAHIQQPPPPPGQQPTHPPPGQQPPPPQPAKPQQVIQHHPSPRHHKSDPYSAGHLREAPSPLMIHSPQMPQFQSLTHQSPPQQNVQPKKQVKGRAEPQPPGPVMGQGQGCPPASPAAVPMLSQELRPPSVVQPQPLVVVKEEKIHSPIIRSEPFSTSLRPEPPKHPENIKAPVHLPQRPEMKPVDIGRPVIRPPEQSAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFEHFRRAAREKEEREKALKAQAEHAEKEKERLRQERMRSREDEDALEQARRAHEEARRRQEQQQQQQQQRQEQQQQQQQAAAVAAASAPQAQSSQPQSMLDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF rpb1_mouse DNA-directed RNA polymerase II subunit RPB1 Polr2a Rpii215 Rpo2-1 DNA-directed RNA polymerase II subunit A DNA-directed RNA polymerase III largest subunit protein protein mouse Mus musculus Mouse MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPASPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN ccnt1_mouse Cyclin-T1 Ccnt1 protein protein mouse Mus musculus Mouse MEGERKNNNKRWYFTREQLENSPSRRFGVDSDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFHRYSMAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPSRLKRIRNWRAYQAAMKTKPDDRGADENTSEQTILNMISQTSSDTTIAGLMSMSTASTSAVPSLPSSEESSSSLTSVDMLQGERWLSSQPPFKLEAAQGHRTSESLALIGVDHSLQQDGSSAFGSQKQASKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAYAAQNLLSHDSHSSVILKMPIESSENPERPFLDKADKSALKMRLPVASGDKAVSSKPEEIKMRIKVHSAGDKHNSIEDSVTKSREHKEKQRTHPSNHHHHHNHHSHRHSHLQLPAGPVSKRPSDPKHSSQTSTLAHKTYSLSSTLSSSSSTRKRGPPEETGAAVFDHPAKIAKSTKSSLNFPFPPLPTMTQLPGHSSDTSGLPFSQPSCKTRVPHMKLDKGPPGANGHNATQSIDYQDTVNMLHSLLSAQGVQPTQAPAFEFVHSYGEYMNPRAGAISSRSGTTDKPRPPPLPSEPPPPLPPLPK larp7_mouse La-related protein 7 D3Wsu161e La ribonucleoprotein domain family member 7 Larp7 protein protein mouse Mus musculus Mouse METENQKTMEESTKRKEEKKKRSRVKQVLADIAKQVDFWFGDANLHKDKFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALKSSSVVELDLEGTRIRRKKPLGERPKDEEERTVYVELLPKNVTHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPSLRVAEEKKKKKKKKGRIKKEESVQAKESAVDSSSSGVCKATKRPRTASEGSEAETPEAPKQPAKKKKKRDKVEASSLPEARAGKRERCSAEDEDCLPPRPKAKKRAQKDGVGQAASEVSKESRDLEFCSTEEEKETDRKGDSLSKVKRKHKKKHKERHKMGEEVIPLRVLSKTEWMDLKKEYLALQKASMASLKKTISQIKLESEMETDCKAPTAGSGQECSTQEKVSAQGPQFVTGVIVKIVSGEPLPGRKQVKDILATISEVVYIDLLEGDTECHARFKTPEDAQAVMNAQTEIRKKHSWNLEVLSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRLAKTQQASQHIRFSEYD 7sk_mouse RNA, 7SK small nuclear snrna small nuclear rna snRNA snrna mouse Mus musculus Mouse srsf1-aurka 1437652 n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437657 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 1D srsf1-tmsb4x 1437652 n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437658 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3A, 3B, 3D, Supp. Fig. 1D, 1F Ongoing transcription may not be a prerequisite for SR proteins to associate with genomic DNA however the association of SR proteins with DNA is dependent on RNA. 7SK RNA plays a major role in mediating the SR protein-promoter DNA interactions. srsf2-srsf1 1437652 n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437660 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 1D srsf1-aurkb 1437652 n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437661 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 1D srsf1-srsf7 1437652 n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437662 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 1D srsf1-magoh 1437652 n/a 1437663 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 1D srsf1-hnrnpl 1437652 n/a 1437664 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 1D srsf1-srsf2 1437652 n/a 1437665 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 1D srsf1-plk1 1437652 n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437666 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 1D srsf1-vim 1437652 n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437667 unspecified role unspecified role prey prey gene_body sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 1D, 1F srsf1-ptpb1 1437652 n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437668 unspecified role unspecified role prey prey gene_body sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Figs. 1D, 1F, 3A Interaction is sensitive to RNase treatment srsf1-srsf6 1437652 n/a 1437669 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 1D srsf1-col1a1 1437652 n/a 1437670 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 1D, 3A Interaction is sensitive to RNase treatment srsf1-hnrnph1 1437652 n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437671 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gene_body sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3A. 3B, 3D, Supp. Fig. 1D, 1F Ongoing transcription may not be a prerequisite for SR proteins to associate with genomic DNA however the association of SR proteins with DNA is dependent on RNA. 7SK RNA plays a major role in mediating the SR protein-promoter DNA interactions. srsf1-rrm2 1437652 n/a 1437672 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 3A Interaction is sensitive to RNase treatment srsf1-rsrc2 1437652 n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437673 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 3A Interaction is sensitive to RNase treatment hexim1-hnrnph1 1437652 n/a 1437674 unspecified role unspecified role bait bait n/a 1437671 unspecified role unspecified role prey prey gene body binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4B, 5F, 5G Supp. Fig. 4A cdk9-hnrnph1 1437652 n/a 1437671 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gene body binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437675 unspecified role unspecified role bait bait association association false false false Fig. 4B, 5F, 5G, Supp. Fig. 4A Interaction is dependent on the presence of SRSF2. Brd4 RNAi also significantly reduced the interaction. cdk9-tmsb4x 1437652 n/a 1437675 unspecified role unspecified role bait bait n/a 1437658 unspecified role unspecified role prey prey gene body binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4B, 5G, Supp. Fig. 4A, 5D Brd4 RNAi significantly reduced the interaction. hexim1-tmsb4x 1437652 n/a 1437658 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gene body binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437674 unspecified role unspecified role bait bait association association false false false Fig. 4B, 5G, Supp. Fig. 4A, 5D cdk9-vim 1437652 n/a 1437675 unspecified role unspecified role bait bait n/a 1437667 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4B hexim1-srsf6 1437652 n/a 1437674 unspecified role unspecified role bait bait n/a 1437669 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5G, Supp. Fig. 5D cdk9-srsf6 1437652 n/a 1437669 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437675 unspecified role unspecified role bait bait association association false false false Fig. 5G, Supp. Fig 5D Brd4 RNAi significantly reduced the interaction. aff4-hnrnph1 1437652 n/a 1437671 unspecified role unspecified role prey prey gene body binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437676 unspecified role unspecified role bait bait association association false false false Fig. 5F brd4-hnrnph1 1437652 n/a 1437677 unspecified role unspecified role bait bait n/a 1437671 unspecified role unspecified role prey prey gene body binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5F srsf2-hrrpnh1 1437652 n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437671 unspecified role unspecified role prey prey gene body binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Figs. 3A, 3B, 3D, 5G, Supp. Figs. 1D, 1F, 4A, Ongoing transcription may not be a prerequisite for SR proteins to associate with genomic DNA however the association of SR proteins with DNA is dependent on RNA. 7SK RNA plays a major role in mediating the SR protein-promoter DNA interactions. Brd4 RNAi significantly reduced the interaction. srsf2-col1a1 1437652 n/a 1437670 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp Fig. 1D, 3A Interaction is sensitive to RNase treatment srsf2-srsf6 1437652 n/a 1437669 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5G, Supp Fig. 1D Brd4 RNAi significantly reduced the interaction. srsf2-ptpb1 1437652 n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437668 unspecified role unspecified role prey prey gene body binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5G, Supp Fig. 1D, 1F, 3A, 4A, Interaction is sensitive to RNase treatment. Brd4 RNAi significantly reduced the interaction. srsf2-vim 1437652 n/a 1437667 unspecified role unspecified role prey prey gene body binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp Fig. 1D, 1F. Supp 4A. srsf2-plk1 1437652 n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437666 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp Fig. 1D srsf2-srsf2 1437652 n/a 1437665 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp Fig. 1D srsf2-hnrnpl 1437652 n/a 1437664 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp Fig. 1D srsf2-magoh 1437652 n/a 1437663 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5G, Supp Fig. 1D Brd4 RNAi significantly reduced the interaction. srsf2-srsf7 1437652 n/a 1437662 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp Fig. 1D srsf2-aurkb 1437652 n/a 1437661 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp Fig. 1D srsf1-srsf1 1437652 n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437660 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp Fig. 1D srsf2-rrm2 1437652 n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437672 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp Fig. 3A Interaction is sensitive to RNase treatment srsf2-rsrc1-1 1437652 n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437673 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp Fig. 3A Interaction is sensitive to RNase treatment hexim1-col1a1 1437652 n/a 1437670 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437674 unspecified role unspecified role bait bait association association false false false Fig. 4B cdk9-col1a1 1437652 n/a 1437675 unspecified role unspecified role bait bait n/a 1437670 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4B hexim1-ptpb1 1437652 n/a 1437668 unspecified role unspecified role prey prey gene body binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437674 unspecified role unspecified role bait bait association association false false false Fig. 5G, Supp Figs. 4A, 5D Interaction is sensitive to RNase treatment cdk9-ptpb1 1437652 n/a 1437668 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gene body binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437675 unspecified role unspecified role bait bait association association false false false Fig. 5G, Supp Fig. 4A, 5D Interaction is sensitive to RNase treatment. Brd4 RNAi significantly reduced the interaction. cdk9-vim-1 1437652 n/a 1437667 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437675 unspecified role unspecified role bait bait association association false false false Supp Fig. 4A hexim1-vim 1437652 n/a 1437667 unspecified role unspecified role prey prey gene body binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437674 unspecified role unspecified role bait bait association association false false false Fig. 4B, Supp Fig. 4A polr2a-hnrnph1 1437652 n/a 1437671 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437678 unspecified role unspecified role bait bait association association false false false Figs. 3A, 5F Supp. Fig. 4A, Ongoing transcription may not be a prerequisite for SR proteins to associate with genomic DNA however the association of SR proteins with DNA is dependent on RNA. 7SK RNA plays a major role in mediating the SR protein-promoter DNA interactions. Protein lacking phosphorylation at the C-terminal region binds only to the promoter region of the gene. Low level of protein phosphorylated to Ser-5 of the tandem 7 residues repeats in the C-terminal domain also bind to the gene body. Protein phosphorylated to Ser-2 of the tandem 7 residues repeats in the C-terminal domain bind to the promoter region, the gene body and to chromatin. Interaction is dependent on the presence of SRSF2 polr2a-ptpb1 1437652 n/a 1437678 unspecified role unspecified role bait bait region (possible) nphosres N-phosphorylated residue NPhosRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437668 unspecified role unspecified role prey prey gene body binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp Fig. 4A, 5D Interaction is sensitive to RNase treatment. Protein phosphorylated at Ser-2 and Ser-5 of the tandem 7 residues repeats in the C-terminal domain bound to the gene. polr2a-vim 1437652 n/a 1437667 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437678 unspecified role unspecified role bait bait association association false false false Supp Fig. 4A polr2a-srsf6 1437652 n/a 1437669 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437678 unspecified role unspecified role bait bait region nphosres N-phosphorylated residue NPhosRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp Fig. 5D Protein phosphorylated at Ser-5 of the tandem 7 residues repeats in the C-terminal domain bound to the gene polr2a-magoh 1437652 n/a 1437678 unspecified role unspecified role bait bait region (possible) nphosres N-phosphorylated residue NPhosRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437663 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp Fig. 5D Protein phosphorylated at Ser-5 of the tandem 7 residues repeats in the C-terminal domain bound to the gene hexim1-magoh 1437652 n/a 1437663 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437674 unspecified role unspecified role bait bait association association false false false Fig. 5G, Supp Fig. 5D cdk9-magoh 1437652 n/a 1437663 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437675 unspecified role unspecified role bait bait association association false false false Fig. 5G, Supp Fig. 5D Interaction is sensitive to RNase treatment srsf2-tmsb4x 1437652 n/a 1437658 unspecified role unspecified role prey prey gene body binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Figs. 3A, 3B, 3D, 5G, Supp Figs. 1D, 1F, 4A Ongoing transcription may not be a prerequisite for SR proteins to associate with genomic DNA however the association of SR proteins with DNA is dependent on RNA. 7SK RNA plays a major role in mediating the SR protein-promoter DNA interactions. Brd4 RNAi significantly reduced the interaction. srsf2-aurka 1437652 n/a 1437657 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp Fig. 1D polr2a-tmsb4x 1437652 n/a 1437658 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437678 unspecified role unspecified role bait bait region (possible) nphosres N-phosphorylated residue NPhosRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3A, Supp Fig. 4A, 5D Ongoing transcription may not be a prerequisite for SR proteins to associate with genomic DNA however the association of SR proteins with DNA is dependent on RNA. 7SK RNA plays a major role in mediating the SR protein-promoter DNA interactions. protein phosphorylated on Ser-5 of the andem 7 residues repeats in the C-terminal domain bound to the gene. brd4-magoh 1437652 n/a 1437663 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437677 unspecified role unspecified role bait bait association association false false false Supp. Fig. 5D brd4-ptpb1 1437652 n/a 1437668 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437677 unspecified role unspecified role bait bait association association false false false Supp. Fig. 5D brd4-srsf6 1437652 n/a 1437669 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437677 unspecified role unspecified role bait bait association association false false false Supp. Fig. 5B brd4-tmsb4x 1437652 n/a 1437677 unspecified role unspecified role bait bait n/a 1437658 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 5D aff4-tmsb4x 1437652 n/a 1437676 unspecified role unspecified role bait bait n/a 1437658 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 5D aff4-srsf6 1437652 n/a 1437669 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437676 unspecified role unspecified role bait bait association association false false false Supp. Fig. 5D aff4-ptpb1 1437652 n/a 1437668 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437676 unspecified role unspecified role bait bait association association false false false Supp. Fig. 5D aff4-magoh 1437652 n/a 1437676 unspecified role unspecified role bait bait n/a 1437663 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 5D srsf1-polr2a 1437653 n/a 1437678 unspecified role unspecified role prey prey n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 5A Polr2a is phosphorylated on residue Serine-2 of the tandem 7 residues repeats in the C-terminal domain. srsf1-7sk 1437653 n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437679 unspecified role unspecified role prey prey n/a 1437675 unspecified role unspecified role prey prey n/a 1437680 unspecified role unspecified role prey prey n/a 1437674 unspecified role unspecified role prey prey n/a 1437681 unspecified role unspecified role prey prey association association false false false Fig. 3E srsf2-7sk 1437653 n/a 1437680 unspecified role unspecified role prey prey n/a 1437675 unspecified role unspecified role prey prey n/a 1437674 unspecified role unspecified role prey prey n/a 1437681 unspecified role unspecified role prey prey n/a 1437679 unspecified role unspecified role prey prey n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3E srsf2-polr2a 1437653 n/a 1437678 unspecified role unspecified role prey prey n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5A, Supp Fig. 5A Polr2a is phosphorylated on residue Serine-2 of the tandem 7 residues repeats in the C-terminal domain. RNase treatment or degradation of the 7SK RNA greatly reduced the association of RNAP II with SRSF2 srsf2-brd4 1437653 n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437677 unspecified role unspecified role prey prey physical association physical association false false false Supp Fig. 6B Depletion of the 7SK RNA with a 2′-O-methyl anti-7SK oligonucleotide partially reduced the interaction between SRSF2 and CDK9 srsf1-hexim1 1437653 n/a 1437674 unspecified role unspecified role prey prey n/a 1437656 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 3C Interaction is RNA-dependent srsf2-hexim1 1437653 n/a 1437659 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437674 unspecified role unspecified role prey prey physical association physical association false false false Supp. Fig. 3C Interaction is RNA-dependent polr2a-srsf1 1437654 n/a 1437678 unspecified role unspecified role bait bait n/a 1437656 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 5B Polr2a is phosphorylated on residue Serine-2 of the tandem 7 residues repeats in the C-terminal domain. polr2a-srsf2 1437654 n/a 1437659 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437678 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5B, Supp Fig. 5B Polr2a is phosphorylated on residue Serine-2 of the tandem 7 residues repeats in the C-terminal domain. RNase treatment or degradation of the 7SK RNA greatly reduced the association of RNAP II with SRSF2 cdk9-srsf2 1437654 n/a 1437659 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437675 unspecified role unspecified role bait bait physical association physical association false false false Supp Fig. 5C Depletion of the 7SK RNA with a 2′-O-methyl anti-7SK oligonucleotide partially reduced the interaction between SRSF2 and CDK9 hexim1-cdk9-2 1437654 n/a 1437674 unspecified role unspecified role bait bait n/a 1437659 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 3C Interaction is RNA-dependent hexim1-cdk9-3 1437654 n/a 1437656 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437674 unspecified role unspecified role bait bait physical association physical association false false false Supp. Fig. 3C Interaction is RNA-dependent hexim1-cdk9-1 1437655 n/a 1437675 unspecified role unspecified role prey prey n/a 1437674 unspecified role unspecified role bait bait n/a 1437656 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1437659 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 3B Interaction is RNA-dependent