MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint zhang-2013h-2 Autophagy modulates miRNA-mediated gene silencing and selectively degrades AIN-1/GW182 in C. elegans. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang P., Zhang H. hongzhang@sun5.ibp.ac.cn EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation zhang-2013h-1 Autophagy modulates miRNA-mediated gene silencing and selectively degrades AIN-1/GW182 in C. elegans. caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang P., Zhang H. hongzhang@sun5.ibp.ac.cn EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation q17740_caeel ain-1 C06G1.4 CELE_C06G1.4 protein protein caeel Caenorhabditis elegans MESLAKNFNNISIDDAAWHPNDQQPVWGNNGLQQQRVWAPPVPQPQFPNRSPWQQESNDIEPNVNEALVGLSGTGSSSQSQWGGIQNTDYEKQIWGDPPLSDVQYPLQPHASFGELNSLGGQSAPWSIGSQPAHPVWSNGGMGKESDDFWKQQQPQQHQQYPMPLLQGAWNTGMRHGPPGQGQRSGPMMQQQQDYQGGWGGPNNMGGNKQMNRPWGQDSNRGMSGMPPRNGRPNHNQGRYSGNMGGGVDVSVPPPMDMHMGGGMGGMRNMGVAPNSGHGSWKNNNAGGGQGGHGGQRNYNNRGGMGHSGSQSGGGSNMWNSTGNNGSGGSMQQFMGGDQQYNNPFPIGGAADDLTLTVWHDPNGELKKWQRDTGVSYWGDPEKQTDRTISLWIVGEGADEDLETALNRCPVPQKKGEDNQRFPFPVPAKRPIVVTGWGELPENDPNNPSKSESTIFDENNRWNDLTTEQNPWYLPNQHTSTFSSDNTTGSWVQGGTIPLNEPGTNQHVAVAEMLKNAVDKGYLDQSVTMMANLPPMVLQYVNMLLVKIPALDSVENELKQIIESSLPEDVKEVDPQNQQKYMNDSQKLEHNRLIIEVTTAKIEVQEYSKKVNRALMDAGIVQPQEQRAPASTEDYHYSFLE lgg1_caeel Protein lgg-1 lgg-1 atg-8.1 C32D5.9 protein protein caeel Caenorhabditis elegans MKWAYKEENNFEKRRAEGDKIRRKYPDRIPVIVEKAPKSKLHDLDKKKYLVPSDLTVGQFYFLIRKRIQLRPEDALFFFVNNVIPQTMTTMGQLYQDHHEEDLFLYIAYSDESVYGGEVEKKE ain_1-lgg_1 1458090 n/a 1458092 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1458093 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f4s lgg_1-ain_1-1 1458090 n/a 1458093 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1458092 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f4t sf4d sf4e sf4f sf4g sf4h sf4i lgg_1-ain_1 1458091 n/a 1458092 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level n/a 1458093 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f4r