MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint singhal-2013-1 Insights into congenital stationary night blindness based on the structure of G90D rhodopsin. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Singhal A., Ostermaier M.K., Vishnivetskiy S.A., Panneels V., Homan K.T., Tesmer J.J., Veprintsev D., Deupi X., Gurevich V.V., Schertler G.F., Standfuss J. joerg.standfuss@psi.ch EMBO Rep. (1469-221X) 2013 imex curation Only protein-protein interactions opsd_bovin Rhodopsin RHO protein protein bovin Bos taurus (Bovine) Bovine MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA mint Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change leading to G-protein activation and release of all-trans retinal gnat1_bovin Guanine nucleotide-binding protein G(t) subunit alpha-1 GNAT1 Transducin alpha-1 chain protein protein bovin Bos taurus (Bovine) Bovine MGAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFATTSIVLFLNKKDVFSEKIKKAHLSICFPDYNGPNTYEDAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impulse that performs the coupling between rhodopsin and cGMP-phosphodiesterase mint gnat1-rho 1459193 n/a 1459194 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified n/a 1459195 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false st1 f1 f3 We obtained crystals of G90D opsin, light-activated G90D and G90D-GaCT2, which diffracted to 3.9, 3.3 and 2.9A° , respectively (supplementary Table S1 online). No crystals of the G90D dark state could be grown. The presence of retinal and the GaCT2 peptide both increased diffraction quality, consistent with their ability to bind and stabilize an active conformation of the receptor.