UniProt UniProt http://www.uniprot.org gori_savellini-2013-1 Toscana Virus NSs protein inhibits the induction of type I interferon by interacting with RIG-I. human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gori-Savellini G., Valentini M., Cusi M.G. Origin of RIG-IC construct according to PMID 15208624 (Fujita T) cusi@unisi.it J. Virol. (0022-538X) 2013 Only protein-protein interactions imex curation gori_savellini-2013- Toscana Virus NSs protein inhibits the induction of type I interferon by interacting with RIG-I. human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gori-Savellini G., Valentini M., Cusi M.G. Origin of RIG-IC construct according to PMID 15208624 (Fujita T) cusi@unisi.it J. Virol. (0022-538X) 2013 Only protein-protein interactions imex curation ddx58_human Antiviral innate immune response receptor RIG-I DEAD box protein 58 Retinoic acid-inducible gene 1 protein DDX58 Probable ATP-dependent RNA helicase DDX58 Retinoic acid-inducible gene I protein RIG-I-like receptor 1 protein protein human Homo sapiens Human MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKFLLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDTNLYSPFKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK nss_tosv Non-structural protein NS-S NSS protein protein tosv Toscana virus Tos MQSRAVILKYRSGSGHKRSLPRFYIDCDLDTFDFEKDCSLIENEFPIYINNYKVVYKSKPTLSHFLIEKEFPAVLGPGMISAVRTRLYEPTMRELYQESIHQLKRSNKKYLLSALRWPTGIPTLEFIDYYFEELLFLSEFDPGSIQRYLKLLVKASGLYNSTNEEQIVEIHRRVLIEGKKHGLTAFDLPGNDILGDICVVQAARVTRLVAKTFSKMTRDTHLMIYFSISPVELVLSKLDKKGDKRAKAKGLMSMSAARSYDYFMRTDLGFRETALSTFWAKDWPTPQETILSDKRCLKEDMRVTKWLPSPPHYPPL nss-ddx58 1391811 n/a 1391813 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1391814 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 ddx58-nss-1 1391811 n/a 1391813 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind range range range range false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1391814 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6a and 6c ddx58-nss 1391812 n/a 1391813 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 1391814 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2