MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint schnur-2013-1 NMR mapping of RANTES surfaces interacting with CCR5 using linked extracellular domains. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr experimental particp experimental participant identification experimental particp Schnur E., Kessler N., Zherdev Y., Noah E., Scherf T., Ding FX., Rabinovich S., Arshava B., Kurbatska V., Leonciks A., Tsimanis A., Rosen O., Naider F., Anglister J. FEBS J. (1742-464X) 2013 ccr5_human C-C chemokine receptor type 5 HIV-1 fusion coreceptor CHEMR13 CCR5 CMKBR5 protein protein human Homo sapiens Human MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL ccl5_human C-C motif chemokine 5 CCL5 D17S136E SCYA5 EoCP Eosinophil chemotactic cytokine SIS-delta Small-inducible cytokine A5 T cell-specific protein P228 T-cell-specific protein RANTES protein protein human Homo sapiens Human MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS ccl5-ccr5 1372385 ccr5_human Nt-ECL1-ECL2 1372386 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.2 ccl5_human RANTES 1372387 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint f2 f5 ccl5-1 1372385 ccl5_human RANTES 1372387 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 direct interaction direct interaction false false false f1 mint ccl5-ccr5-1 1372385 ccr5_human Nt-CCR5 1372386 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified sulfotyrosine osulftyr O4'-sulfo-L-tyrosine (S)-2-amino-3-(4-sulfooxyphenyl)propanoic acid MOD_RES Sulfotyrosine O4-sulfotyrosine tyrosine sulfate tyrosine-O-sulfonic acid tyrosine-O-sulphonic acid 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-sulfate O4'-sulfo-L-tyrosine O-Sulfonation OSulfTyr Sulfo Sulphation (of O of Tyrosine) Tyrosinyl Sulphate sulfationy certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm sulfotyrosine osulftyr O4'-sulfo-L-tyrosine (S)-2-amino-3-(4-sulfooxyphenyl)propanoic acid MOD_RES Sulfotyrosine O4-sulfotyrosine tyrosine sulfate tyrosine-O-sulfonic acid tyrosine-O-sulphonic acid 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-sulfate O4'-sulfo-L-tyrosine O-Sulfonation OSulfTyr Sulfo Sulphation (of O of Tyrosine) Tyrosinyl Sulphate sulfationy certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ccl5_human RANTES 1372387 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1372385 homomint mint f3 f4b f5a ccl5-ccr5-2 1372385 ccr5_human Nt-CCR5 1372386 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified sulfotyrosine osulftyr O4'-sulfo-L-tyrosine (S)-2-amino-3-(4-sulfooxyphenyl)propanoic acid MOD_RES Sulfotyrosine O4-sulfotyrosine tyrosine sulfate tyrosine-O-sulfonic acid tyrosine-O-sulphonic acid 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-sulfate O4'-sulfo-L-tyrosine O-Sulfonation OSulfTyr Sulfo Sulphation (of O of Tyrosine) Tyrosinyl Sulphate sulfationy certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sulfotyrosine osulftyr O4'-sulfo-L-tyrosine (S)-2-amino-3-(4-sulfooxyphenyl)propanoic acid MOD_RES Sulfotyrosine O4-sulfotyrosine tyrosine sulfate tyrosine-O-sulfonic acid tyrosine-O-sulphonic acid 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-sulfate O4'-sulfo-L-tyrosine O-Sulfonation OSulfTyr Sulfo Sulphation (of O of Tyrosine) Tyrosinyl Sulphate sulfationy certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm Stoichiometry: 1.2 ccl5_human RANTES 1372387 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.1 direct interaction direct interaction false false false 1372385 homomint mint f3 f4a f5a ccl5-ccr5-3 1372385 ccl5_human RANTES 1372387 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ccr5_human ECL1-ECL2 1372386 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1372385 f6 homomint mint