MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint babenko-2013-1 Amino acid sequence determinants in self-assembly of insulin chiral amyloid superstructures: role of C-terminus of B-chain in association of fibrils. in vitro In vitro atomic force microsc atomic force microscopy AFM AFM atomic force microsc experimental particp experimental participant identification experimental particp Babenko V., Dzwolak W. FEBS Lett. (0014-5793) 2013 babenko-2013-3 Amino acid sequence determinants in self-assembly of insulin chiral amyloid superstructures: role of C-terminus of B-chain in association of fibrils. in vitro In vitro cd circular dichroism CD CD cd experimental particp experimental participant identification experimental particp Babenko V., Dzwolak W. FEBS Lett. (0014-5793) 2013 babenko-2013-2 Amino acid sequence determinants in self-assembly of insulin chiral amyloid superstructures: role of C-terminus of B-chain in association of fibrils. in vitro In vitro ir spectrometry infrared spectroscopy ir spectrometry experimental particp experimental participant identification experimental particp Babenko V., Dzwolak W. FEBS Lett. (0014-5793) 2013 ins_bovin Insulin INS protein protein bovin Bos taurus (Bovine) Bovine MALWTRLRPLLALLALWPPPPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEGPQVGALELAGGPGAGGLEGPPQKRGIVEQCCASVCSLYQLENYCN lysc_chick Lysozyme C LYZ 1,4-beta-N-acetylmuramidase C Allergen Gal d IV protein protein chick Gallus gallus (Chicken) Chicken MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL lalba_bovin Alpha-lactalbumin LALBA ALACTA Lactose synthase B protein protein protein bovin Bos taurus (Bovine) Bovine MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL mint homomint Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins ins_human Insulin INS protein protein human Homo sapiens Human MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver mint homomint Defects in INS are the cause of familial hyperproinsulinemia [MIM:176730] ins_pig Insulin INS protein protein pig Sus scrofa (Pig) Pig MALWTRLLPLLALLALWAPAPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAENPQAGAVELGGGLGGLQALALEGPPQKRGIVEQCCTSICSLYQLENYCN Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver mint ins-ins-12 1363791 ins_bovin BI 1363794 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ins_bovin BI 1363794 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false mint f2a f2b f2c f2d f4d f4h lyz-lyz-5 1363791 lysc_chick HEWL 1363795 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified lysc_chick HEWL 1363795 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f4b homomint mint lalba-lalba-1 1363791 lalba_bovin α-LAC 1363796 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified lalba_bovin α-LAC 1363796 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f4c homomint mint ins-ins-13 1363791 ins_human HI 1363797 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ins_human HI 1363797 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f4e homomint mint ins-ins-14 1363791 ins_pig PI 1363798 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ins_pig PI 1363798 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f4f mint ins-ins-16 1363792 ins_bovin BI 1363794 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ins_bovin BI 1363794 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false mint f2f f3 ins-ins-17 1363792 ins_human HI 1363797 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ins_human HI 1363797 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f3 homomint mint ins-ins-18 1363792 ins_pig PI 1363798 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ins_pig PI 1363798 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f3 mint lyz-lyz-6 1363792 lysc_chick HEWL 1363795 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified lysc_chick HEWL 1363795 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f3 homomint mint lalba-lalba-2 1363792 lalba_bovin α-LAC 1363796 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified lalba_bovin α-LAC 1363796 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f3 homomint mint ins-ins-15 1363793 ins_bovin BI 1363794 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ins_bovin BI 1363794 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f2e mint