IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ li-2012i-1 Foxa2 and H2A.Z mediate nucleosome depletion during embryonic stem cell differentiation. mouse-ehp cells Mouse endoderm/hepatic progenitor cells endoderm_hepatic_progenitor endoderm/hepatic progenitor ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Li Z., Gadue P., Chen K., Jiao Y., Tuteja G., Schug J., Li W., Kaestner K.H. Partially differentiated EHP cells. kaestner@mail.med.upenn.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation li-2012i-3 Foxa2 and H2A.Z mediate nucleosome depletion during embryonic stem cell differentiation. mouse-ehp cells Mouse endoderm/hepatic progenitor cells endoderm_hepatic_progenitor endoderm/hepatic progenitor ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Li Z., Gadue P., Chen K., Jiao Y., Tuteja G., Schug J., Li W., Kaestner K.H. Partially differentiated EHP cells. RE-ChIp:Two rounds of ChIP performed, using two sequential anti-bait Abs. the second bait is described, with the first round bait being taken as a prey molecule. kaestner@mail.med.upenn.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation li-2012i-2 Foxa2 and H2A.Z mediate nucleosome depletion during embryonic stem cell differentiation. mouse-ehp cells Mouse endoderm/hepatic progenitor cells endoderm_hepatic_progenitor endoderm/hepatic progenitor anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li Z., Gadue P., Chen K., Jiao Y., Tuteja G., Schug J., Li W., Kaestner K.H. kaestner@mail.med.upenn.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation np1l1_mouse Nucleosome assembly protein 1-like 1 NAP-1-related protein Brain protein DN38 Nap1l1 Nrp protein protein mouse Mus musculus Mouse MADIDNKEQSELDQDLEDVEEVEEEETGEETKIKARQLTVQMMQNPQILAALQERLDGLVDTPTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEVSEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNDYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPENGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ albu_mouse_gene Serum albumin gene gene gene mouse Mus musculus Mouse smca4_mouse Transcription activator BRG1 Smarca4 Baf190a Brg1 Snf2b Snf2l4 ATP-dependent helicase SMARCA4 BRG1-associated factor 190A Protein brahma homolog 1 SNF2-beta SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4 protein protein mouse Mus musculus Mouse MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPMPTQGPGGYPQDNMHQMHKPMESMHEKGMPDDPRYNQMKGMGMRSGAHTGMAPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGSDPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPLVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQPAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED kat5_mouse Histone acetyltransferase KAT5 Kat5 Htatip Tip60 Lysine acetyltransferase 5 Histone acetyltransferase HTATIP 60 kDa Tat-interactive protein protein protein mouse Mus musculus Mouse MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW tthy_mouse_gene Transthyretin gene gene gene mouse Mus musculus Mouse hnf4a_mouse_gene Hepatocyte nuclear factor 4-alpha gene gene gene mouse Mus musculus Mouse apoa1_mouse_gene Apolipoprotein A-I gene gene gene mouse Mus musculus Mouse cxcr4_mouse_gene C-X-C chemokine receptor type 4 gene gene gene mouse Mus musculus Mouse feta_mouse_gene Alpha-fetoprotein gene gene gene mouse Mus musculus Mouse ibp5_mouse_gene Insulin-like growth factor-binding protein 5 gene gene gene mouse Mus musculus Mouse sox17_mouse_gene SOX17_MOUSE_GENE gene gene mouse Mus musculus Mouse foxa2_mouse_gene Hepatocyte nuclear factor 3-beta gene gene gene mouse Mus musculus Mouse wnt7a_mouse_gene Wnt7a gene gene gene mouse Mus musculus Mouse foxa2_mouse Hepatocyte nuclear factor 3-beta Foxa2 Hnf3b Tcf-3b Tcf3b Forkhead box protein A2 protein protein mouse Mus musculus Mouse MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGGGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMSGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAASSGGKKTAPGSQASQAQLGEAAGSASETPAGTESPHSSASPCQEHKRGGLSELKGAPASALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGGYGSPMPGSLAMGPVTNKAGLDASPLAADTSYYQGVYSRPIMNSS h2az_mouse Histone H2A.Z H2az1 H2afz H2az protein protein mouse Mus musculus Mouse MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV nap1l1-albu 1385862 n/a 1385865 unspecified role unspecified role bait bait n/a 1385866 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A smarca4-albu 1385862 n/a 1385866 unspecified role unspecified role prey prey n/a 1385867 unspecified role unspecified role bait bait association association false false false Supp. Fig. 4A kat5-albu 1385862 n/a 1385868 unspecified role unspecified role bait bait n/a 1385866 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A nap1l1-tthy 1385862 n/a 1385865 unspecified role unspecified role bait bait n/a 1385869 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A smarca4-tthy 1385862 n/a 1385869 unspecified role unspecified role prey prey n/a 1385867 unspecified role unspecified role bait bait association association false false false Supp. Fig. 4A kat5-tthy 1385862 n/a 1385869 unspecified role unspecified role prey prey n/a 1385868 unspecified role unspecified role bait bait association association false false false Supp. Fig. 4A nap1l1-hnf4a 1385862 n/a 1385870 unspecified role unspecified role prey prey n/a 1385865 unspecified role unspecified role bait bait association association false false false Supp. Fig. 4A smarca4-hnf4a 1385862 n/a 1385867 unspecified role unspecified role bait bait n/a 1385870 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A kat5-hnf4a 1385862 n/a 1385868 unspecified role unspecified role bait bait n/a 1385870 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A nap1l1-apoa1 1385862 n/a 1385865 unspecified role unspecified role bait bait n/a 1385871 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. smarca4-apoa1 1385862 n/a 1385867 unspecified role unspecified role bait bait n/a 1385871 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. kat5-apoa1 1385862 n/a 1385871 unspecified role unspecified role prey prey n/a 1385868 unspecified role unspecified role bait bait association association false false false Supp. Fig. 4A, 4C Occupancy of Kat5 at nucleosome depletion regions was impaired by H2A.Z suppression nap1l1-cxcr4 1385862 n/a 1385865 unspecified role unspecified role bait bait n/a 1385872 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A smarca4-cxcr4 1385862 n/a 1385872 unspecified role unspecified role prey prey n/a 1385867 unspecified role unspecified role bait bait association association false false false Supp. Fig. 4A kat5-cxcr4 1385862 n/a 1385872 unspecified role unspecified role prey prey n/a 1385868 unspecified role unspecified role bait bait association association false false false Supp. Fig. 4A nap1l1-feta 1385862 n/a 1385873 unspecified role unspecified role prey prey n/a 1385865 unspecified role unspecified role bait bait association association false false false Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. smarca4-feta 1385862 n/a 1385867 unspecified role unspecified role bait bait n/a 1385873 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. kat5-feta 1385862 n/a 1385868 unspecified role unspecified role bait bait n/a 1385873 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A, 4C Occupancy of Kat5 at nucleosome depletion regions was impaired by H2A.Z suppression nap1l1-ibp5 1385862 n/a 1385865 unspecified role unspecified role bait bait n/a 1385874 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. smarca4-ibp5 1385862 n/a 1385867 unspecified role unspecified role bait bait n/a 1385874 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. kat5-ibp5 1385862 n/a 1385874 unspecified role unspecified role prey prey n/a 1385868 unspecified role unspecified role bait bait association association false false false Supp. Fig. 4A, 4C Occupancy of Kat5 at nucleosome depletion regions was impaired by H2A.Z suppression nap1l1-sox17 1385862 n/a 1385865 unspecified role unspecified role bait bait n/a 1385875 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A smarca4-sox17 1385862 n/a 1385875 unspecified role unspecified role prey prey n/a 1385867 unspecified role unspecified role bait bait association association false false false Supp. Fig. 4A kat5-sox17 1385862 n/a 1385868 unspecified role unspecified role bait bait n/a 1385875 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A nap1l1-foxa2 1385862 n/a 1385865 unspecified role unspecified role bait bait n/a 1385876 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A smarca4-foxa2 1385862 n/a 1385867 unspecified role unspecified role bait bait n/a 1385876 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A kat5-foxa2 1385862 n/a 1385868 unspecified role unspecified role bait bait n/a 1385876 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A nap1l1-wnt7a 1385862 n/a 1385877 unspecified role unspecified role prey prey n/a 1385865 unspecified role unspecified role bait bait association association false false false Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. smarca4-wnt7a 1385862 n/a 1385867 unspecified role unspecified role bait bait n/a 1385877 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4A, 4C Occupancy impaired when Foxa2 expression was suppressed by RNAi during ES cell differentiation. kat5-wnt7a 1385862 n/a 1385877 unspecified role unspecified role prey prey n/a 1385868 unspecified role unspecified role bait bait association association false false false Supp. Fig. 4A, 4C Occupancy of Kat5 at nucleosome depletion regions was impaired by H2A.Z suppression foxa2-albu 1385863 n/a 1385866 unspecified role unspecified role prey prey n/a 1385878 unspecified role unspecified role bait bait n/a 1385879 unspecified role unspecified role prey prey association association false false false Supp. Fig. 2E h2afz-albu-1 1385863 n/a 1385879 unspecified role unspecified role bait bait n/a 1385878 unspecified role unspecified role prey prey n/a 1385866 unspecified role unspecified role prey prey association association false false false Supp. Fig. 2E h2afz-foxa2-1 1385863 n/a 1385869 unspecified role unspecified role prey prey n/a 1385878 unspecified role unspecified role prey prey n/a 1385879 unspecified role unspecified role bait bait association association false false false Supp. Fig. 2E foxa2-tthy 1385863 n/a 1385879 unspecified role unspecified role prey prey n/a 1385878 unspecified role unspecified role bait bait n/a 1385869 unspecified role unspecified role prey prey association association false false false Supp. Fig. 2E foxa2-hnf4a 1385863 n/a 1385879 unspecified role unspecified role prey prey n/a 1385870 unspecified role unspecified role prey prey n/a 1385878 unspecified role unspecified role bait bait association association false false false Supp. Fig. 2E h2afz-foxa2-2 1385863 n/a 1385879 unspecified role unspecified role bait bait n/a 1385870 unspecified role unspecified role prey prey n/a 1385878 unspecified role unspecified role prey prey association association false false false Supp. Fig. 2E h2afz-apoa1-1 1385863 n/a 1385878 unspecified role unspecified role prey prey n/a 1385871 unspecified role unspecified role prey prey n/a 1385879 unspecified role unspecified role bait bait association association false false false Supp. Fig. 2E foxa2-apoa1-1 1385863 n/a 1385871 unspecified role unspecified role prey prey n/a 1385879 unspecified role unspecified role prey prey n/a 1385878 unspecified role unspecified role bait bait association association false false false Supp. Fig. 2E h2afz-cxcr4-1 1385863 n/a 1385878 unspecified role unspecified role prey prey n/a 1385879 unspecified role unspecified role bait bait n/a 1385872 unspecified role unspecified role prey prey association association false false false Supp. Fig. 2E foxa2-cxcr4-1 1385863 n/a 1385879 unspecified role unspecified role prey prey n/a 1385878 unspecified role unspecified role bait bait n/a 1385872 unspecified role unspecified role prey prey association association false false false Supp. Fig. 2E h2afz-feta-1 1385863 n/a 1385879 unspecified role unspecified role bait bait n/a 1385878 unspecified role unspecified role prey prey n/a 1385873 unspecified role unspecified role prey prey association association false false false Supp. Fig. 2E foxa2-feta 1385863 n/a 1385879 unspecified role unspecified role prey prey n/a 1385878 unspecified role unspecified role bait bait n/a 1385873 unspecified role unspecified role prey prey association association false false false Supp. Fig. 2E foxa2-ibp5 1385863 n/a 1385874 unspecified role unspecified role prey prey n/a 1385879 unspecified role unspecified role prey prey n/a 1385878 unspecified role unspecified role bait bait association association false false false Supp. Fig. 2E h2afz-ibp5 1385863 n/a 1385879 unspecified role unspecified role bait bait n/a 1385878 unspecified role unspecified role prey prey n/a 1385874 unspecified role unspecified role prey prey association association false false false Supp. Fig. 2E h2afz-sox17 1385863 n/a 1385878 unspecified role unspecified role prey prey n/a 1385879 unspecified role unspecified role bait bait n/a 1385875 unspecified role unspecified role prey prey association association false false false Supp. Fig. 2E foxa2-h2afz-1 1385863 n/a 1385879 unspecified role unspecified role prey prey n/a 1385875 unspecified role unspecified role prey prey n/a 1385878 unspecified role unspecified role bait bait association association false false false Supp. Fig. 2E foxa2-foxa2 1385863 n/a 1385878 unspecified role unspecified role bait bait n/a 1385879 unspecified role unspecified role prey prey n/a 1385876 unspecified role unspecified role prey prey association association false false false Supp. Fig. 2E h2afz-foxa2 1385863 n/a 1385879 unspecified role unspecified role bait bait n/a 1385878 unspecified role unspecified role prey prey n/a 1385876 unspecified role unspecified role prey prey association association false false false Supp. Fig. 2E foxa2-wnt7a 1385863 n/a 1385878 unspecified role unspecified role bait bait n/a 1385877 unspecified role unspecified role prey prey n/a 1385879 unspecified role unspecified role prey prey association association false false false Supp. Fig. 2E h2afz-wnt7a 1385863 n/a 1385878 unspecified role unspecified role prey prey n/a 1385877 unspecified role unspecified role prey prey n/a 1385879 unspecified role unspecified role bait bait association association false false false Supp. Fig. 2E h2afz-foxa2 1385864 n/a 1385867 unspecified role unspecified role prey prey n/a 1385878 unspecified role unspecified role prey prey n/a 1385879 unspecified role unspecified role bait bait n/a 1385868 unspecified role unspecified role prey prey n/a 1385865 unspecified role unspecified role prey prey association association false false false Fig. 3D foxa2-h2afz 1385864 n/a 1385867 unspecified role unspecified role prey prey n/a 1385865 unspecified role unspecified role prey prey n/a 1385879 unspecified role unspecified role prey prey n/a 1385878 unspecified role unspecified role bait bait n/a 1385868 unspecified role unspecified role prey prey association association false false false Fig. 3D