IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ liu-2012g-2 PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] liu-2012g-5 PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] liu-2012g-1 PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] liu-2012g-3 PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] liu-2012g-4 PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] liu-2012g-6 PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] liu-2012g-7 PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. mouse-brain_hippocampal_neuron Mus musculus, brain, hippocampal neurons brain-hippocampus_neuron Hippocampal neuron fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] liu-2012g-8 PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease Dorsal root ganglion neurons. The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] liu-2012g-9 PACSIN1, a Tau-interacting protein, regulates axonal elongation and branching by facilitating microtubule instability. mouse-brain Mus musculus brain brain Brain [cerebrum] fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Liu Y., Lv K., Li Z., Yu A.C., Chen J., Teng J. Alzheimers - Interactions investigated in the context of Alzheimers disease The Tau "mbd" has been deduced to be amino acids 243-367 from Fig 6, Kanai-1992 (Ref 26). The authors state that "TauL4Delta-MBD" is only amino acids 1-242, without C-terminal tail region, as shown in figure 1D. The authors state that the constructs His-PACSIN1 and His-PACSIN1P434L were subcloned into pET28a vector using EcoRI/XhoI sites for protein expression with a His tag located in the N terminus of PACSIN1. chenjg@pku.edu.cn, junlinteng@pku.edu.cn J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving Tubulin have not been entered as the exact identity of Tubulin is not known. Tau has been entered as (Rat) UniProt ID P19332-5 (with 432 amino acids) -as identified from Kanai et al., 1992 and 1989. [Kanai-1989 (PMID:2504728), Figure 1 gives the complete sequence of pTAU-16 which has 432 amino acids.] p19332-5 Microtubule-associated protein tau Mapt Mtapt Tau Neurofibrillary tangle protein Paired helical filament-tau protein protein rat Rattus norvegicus (Rat) Rat MAEPRQEFDTMEDQAGDYTMLQDQEGDMDHGLKESPPQPPADDGSEEPGSETSDAKSTPTAEDVTAPLVEERAPDKQATAQSHTEIPEGTTAEEAGIGDTPNMEDQAAGHVTQARVAGVSKDRTGNDEKKAKGADGKTGAKIATPRGAATPGQKGTSNATRIPAKTTPSPKTPPGSGEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVHIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL pacn1_mouse Protein kinase C and casein kinase substrate in neurons protein 1 Pacsin Pacsin1 Syndapin-1 protein protein mouse Mus musculus Mouse MSGSYDEASEEITDSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTAKKEKQPKKAEGATLSNATGAVESTSQAGDRGSVSSYDRGQTYATEWSDDESGNPFGGNEANGGANPFEDDAKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEAI tau_mouse Microtubule-associated protein tau Neurofibrillary tangle protein Paired helical filament-tau Mapt Mtapt Tau protein protein mouse Mus musculus Mouse MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKESPPQPPADDGAEEPGSETSDAKSTPTAEDVTAPLVDERAPDKQAAAQPHTEIPEGITAEEAGIGDTPNQEDQAAGHVTQGRREGQAPDLGTSDWTRQQVSSMSGAPLLPQGLREATCQPSGTRPEDIEKSHPASELLRRGPPQKEGWGQDRLGSEEEVDEDLTVDESSQDSPPSQASLTPGRAAPQAGSGSVCGETASVPGLPTEGSVPLPADFFSKVSAETQASQPEGPGTGPMEEGHEAAPEFTFHVEIKASTPKEQDLEGATVVGVPGEEQKAQTQGPSVGKGTKEASLQEPPGKQPAAGLPGRPVSRVPQLKARVASKDRTGNDEKKAKTSTPSCAKAPSHRPCLSPTRPTLGSSDPLIKPSSPAVSPEPATSPKHVSSVTPRNGSPGTKQMKLKGADGKTGAKIATPRGAASPAQKGTSNATRIPAKTTPSPKTPPGSGEPPKSGERSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLKNVRSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL mapt-pacsin1-1 1438049 n/a 1438058 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false delta_microtubule_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1438059 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] physical association physical association false false false 1A mapt-pacsin1-3 1438049 n/a 1438060 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] n/a 1438059 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 1B mapt-pacsin1-6 1438050 n/a 1438058 unspecified role unspecified role bait bait n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1438059 unspecified role unspecified role prey prey n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 1F pacsin1-mapt 1438050 n/a 1438059 unspecified role unspecified role bait bait n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1438058 unspecified role unspecified role prey prey n_terminus rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 1Fi mapt-pacsin1 1438051 n/a 1438059 unspecified role unspecified role prey prey mouse-brain Mus musculus brain brain Brain [cerebrum] n/a 1438058 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false delta_microtubule_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Supp 1B mapt-pacsin1-4 1438052 n/a 1438059 unspecified role unspecified role prey prey n/a 1438058 unspecified role unspecified role bait bait delta_microtubule_binding_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1C mapt-pacsin1-5 1438053 n/a 1438059 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q61644:p.Pro434Leu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false mouse-brain Mus musculus brain brain Brain [cerebrum] n/a 1438058 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false proline_rich_domain sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1E pacsin1-mapt-1 1438054 n/a 1438059 unspecified role unspecified role bait bait n/a 1438060 unspecified role unspecified role prey prey physical association physical association false false false 1G mapt-pacsin1-9 1438055 n/a 1438059 unspecified role unspecified role neutral component neutral component n/a 1438060 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2A/B mapt-pacsin1-10 1438056 n/a 1438060 unspecified role unspecified role neutral component neutral component n/a 1438059 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2C/D mapt-pacsin1-11 1438057 n/a 1438059 unspecified role unspecified role neutral component neutral component n/a 1438060 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Supp 3 Pascsin1 and tau co-localized in corpus callosa and mossy fibers in hippocampal region.