MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint h_pker-2012-1 AATF/Che-1 acts as a phosphorylation-dependent molecular modulator to repress p53-driven apoptosis. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Höpker K., Hagmann H., Khurshid S., Chen S., Hasskamp P., Seeger-Nukpezah T., Schilberg K., Heukamp L., Lamkemeyer T., Sos ML., Thomas RK., Lowery D., Roels F., Fischer M., Liebau MC., Resch U., Kisner T., Röther F., Bartram MP., Müller RU., Fabretti F., Kurschat P., Schumacher B., Gaestel M., Medema RH., Yaffe MB., Schermer B., Reinhardt HC., Benzing T. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation h_pker-2012-2 AATF/Che-1 acts as a phosphorylation-dependent molecular modulator to repress p53-driven apoptosis. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid experimental particp experimental participant identification experimental particp Höpker K., Hagmann H., Khurshid S., Chen S., Hasskamp P., Seeger-Nukpezah T., Schilberg K., Heukamp L., Lamkemeyer T., Sos ML., Thomas RK., Lowery D., Roels F., Fischer M., Liebau MC., Resch U., Kisner T., Röther F., Bartram MP., Müller RU., Fabretti F., Kurschat P., Schumacher B., Gaestel M., Medema RH., Yaffe MB., Schermer B., Reinhardt HC., Benzing T. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation h_pker-2012-3 AATF/Che-1 acts as a phosphorylation-dependent molecular modulator to repress p53-driven apoptosis. in vitro In vitro protein kinase assay protein kinase assay experimental particp experimental participant identification experimental particp Höpker K., Hagmann H., Khurshid S., Chen S., Hasskamp P., Seeger-Nukpezah T., Schilberg K., Heukamp L., Lamkemeyer T., Sos ML., Thomas RK., Lowery D., Roels F., Fischer M., Liebau MC., Resch U., Kisner T., Röther F., Bartram MP., Müller RU., Fabretti F., Kurschat P., Schumacher B., Gaestel M., Medema RH., Yaffe MB., Schermer B., Reinhardt HC., Benzing T. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation q6zwq9_mouse Myl12a 2900073G15Rik Myl12b Gm49909 protein protein mouse Mus musculus Mouse MSSKRAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASMGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEAIGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD mint homomint aatf_human Protein AATF Apoptosis-antagonizing transcription factor Rb-binding protein Che-1 AATF CHE1 DED HSPC277 protein protein human Homo sapiens Human MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLRSLVGLQEELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVLGKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTTMNDDARTELYRSLFGQLHPPDEGHGD mapk2_human MAP kinase-activated protein kinase 2 MAPKAPK2 protein protein human Homo sapiens Human MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH myl12a-aatf 1363871 q6zwq9_mouse MRLC3 1363874 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false aatf_human AATF 1363875 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint mint sf1b sf1c f1c f1d aatf-myl12a 1363871 q6zwq9_mouse MRLC3 1363874 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false aatf_human AATF 1363875 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1e homomint mint myl12a-aatf-1 1363872 q6zwq9_mouse MRLC3 1363874 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false aatf_human AATF 1363875 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cdna library cdna library fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false nfa homomint mint aatf-mapkapk2 1363873 mapk2_human MK2 1363876 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified aatf_human AATF 1363875 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylation phosphorylation reaction phosphorylation false false false homomint sf3 mint