MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint labit-2012-1 Dephosphorylation of Cdc20 is required for its C-box-dependent activation of the APC/C. in vitro In vitro pull down pull down experimental particp experimental participant identification experimental particp Labit H., Fujimitsu K., Bayin NS., Takaki T., Gannon J., Yamano H. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation labit-2012-2 Dephosphorylation of Cdc20 is required for its C-box-dependent activation of the APC/C. xenla- Xenopus laevis egg egg anti bait coip anti bait coimmunoprecipitation anti bait coip experimental particp experimental participant identification experimental particp Labit H., Fujimitsu K., Bayin NS., Takaki T., Gannon J., Yamano H. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation labit-2012-3 Dephosphorylation of Cdc20 is required for its C-box-dependent activation of the APC/C. xenla- Xenopus laevis egg egg anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Labit H., Fujimitsu K., Bayin NS., Takaki T., Gannon J., Yamano H. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation q8avg7_xenla cdc20.S cdc20 XELAEV_18025163mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAQFAFETDINSILKLDTPITNAPLARWQRKAKEGNCSLNTSANTSTMSPMKTSNRSHSSSKTPSKTPGKSGQKMQGTPSRAGGDRFIPNRSAMQMDVASFLLSKENEPTDTSPTKKEQQKAWAMNLNGFDMEEAKILRLGGRPQNAPEGYQNNLKVLYSQKNTPGSSKKTGRYIPSMPDRVLDAPDIRNDYYLNLIDWSSQNALAVALNDSVYLWNYATGDIILLLQMENSEEYISSVSWIKEGHFLAVGTSNSEVQLWDVQQQKRLRNMISHSSRVGALSWNNHILSSGSRTGHIHHHDVRVAQHHVSTLTGHTQEVCGLKWSPDGRYLASGANDNLVNVWPCVQGDSGEFSPVQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGTCLNSVDTHSQVCSILWSANYKELISGHGFAQNQLVLWKYPTMTRVSELKGHTARVLNLAMSPDGCTVASAAADETLRLWKCFEVDPVTKKEKEKSRSSKSIIHQSIR mint q0p4v8_xentr cdc27 MGC145551 protein protein xentr Xenopus tropicalis (Western clawed frog) Silurana tropicalis MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKAHSCATPQCKYLLAKCCVDLSKLAEGEQILSGGVLNKQKSQEEIVTEFGDSACFTLSLLGHVYCKTDRLAKGAECYQKSLSLNPFLWSPFESLCEIGEKPDPEQTFKLTSLQNFSNCLPNTCTMTVNTHSVVQHRQPDTVLMETPQDTIELNRLNLESSNMKYPLNSDSSISYIDPGVISPDSLPLGTGTSILSKQAQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQTYSSCVLDVPSSGAPTKKSVARISQAGTKSVFSQSGNSRDVTPVLLVQTQGSGPQTSTTPQVLSPTIAAPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKMPNRKTKSKTSKGGVTQANMNDSLEISKLDSSIISEGKISSVAPQIQALTIQKAAAEGLMSLLRDMGKGYVALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELAEYLQAERVFSEVRRIESYRVEGMEIYSTTLWHLQKDVTLSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPGYAYAFTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSDKALDTLNKAISIDPKNPLCKFHRASILFANEKYKLALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEAVTQEEQISECYPYESVATDESQESSMTDADDTQLHAAESDEF mint q6dfi7_xenla cdc16.L cdc16 cdc16-prov XELAEV_18012976mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MNLDRLRKRVRQYIEQQQYQSALFWADKVASLSHEEPQDIYWLAQCLYLTAQYHRASHALRSRKLDKVHEACRYLAARCHYAAKEYQQALDILDMEEPINKKLFEKSLKEDLKEPSGEWQMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKFDVYCFEAFDLLTAHHMLTAQEEKELLDSLPLSKKCSEDQELLRFLYENKLKKYNKPSETLIPESADGLQENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHANCLPVHIGTLVELNKANELFYLSHKLVDLYPNNPVSWFAVGCYYLMVGHKNEHARRYLSKATALERSYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGDWKTAEKWFLDALEKIRVIGDEVTVDKWEPLLNNLGHVLRKLKKYDEALEYHRQALVLIPQNASTYSAIGYIHSLMGNFESAIDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSDAYIGTEIKDKLRCYDFDVHTMKTLKNIISPPWEEREFDFERQSLDESGIMALETSNLLPKSSDTRSPIEEALEIEMNESDMMLETSMSDHST q7t0n9_xenla cdc23.L cdc23 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAATIGMFSDLKEIKRQLLSVTWLCRERGLMNSVKWASELAFSLESVPLNELPSTPALTEEDAQDLDAYMLAKSYFDLKEYDRAAYFLRGCKSQKAYFMYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALREVRVELSKKHKARELDGFGLYLYGVVLRKLDLAKEALDVFVEATHVLPLHWGTWLELCNLITDKEMLKFLSLPDSWIKEFFLAHIYTELQLIEEALQKYQSLIDAGFSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRGLKPELSYLAHNLCDIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQCYIKYIQDIYSCGEIVEHQEVSTAFRYLAQYYFKCKLWDEASACAQKCFNFNDTREEGKALLRQILQLRNQSESPSAEPATAPFFLPQSLSANNTPTRRVSPLNLSSVTP cdc20-cdc16 1353589 cdc20 cdc20 1353592 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false apc3 Apc3 1353593 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level apc6 Apc6 1353594 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false mint f2a f6b cdc20-cdc16-1 1353589 cdc20 cdc20 1353592 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false apc6 Apc6 1353594 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f6c mint cdc20-cdc23 1353589 cdc20 cdc20 1353592 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false apc8 Apc8 1353595 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f6c mint cdc27-cdc20-3 1353590 cdc20 cdc20 1353592 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level apc3 Apc3 1353593 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f2c mint cdc23-cdc20 1353591 cdc20 cdc20 1353592 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false apc8 Apc8 1353595 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q7T0N9:p.Asn321Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false mint f6d f6e