UniProt UniProt http://www.uniprot.org arboleda-2012-1 Mutations in the PCNA-binding domain of CDKN1C cause IMAGe syndrome. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Arboleda V.A., Lee H., Parnaik R., Fleming A., Banerjee A., Ferraz-de-Souza B., Délot E.C., Rodriguez-Fernandez I.A., Braslavsky D., Bergadá I., Dell'Angelica E.C., Nelson S.F., Martinez-Agosto J.A., Achermann J.C., Vilain E. Interactions fig. S5c omitted as the involved 'importin-alpha' (detected by western blot) cannot be mapped to a UniProt Ac No. evilain@ucla.edu Nat. Genet. (1061-4036) 2012 Only protein-protein interactions imex curation cdn1c_human Cyclin-dependent kinase inhibitor 1C Cyclin-dependent kinase inhibitor p57 p57Kip2 CDKN1C KIP2 protein protein human Homo sapiens Human MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR pcna_human Proliferating cell nuclear antigen PCNA Cyclin protein protein human Homo sapiens Human MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS cdkn1c-pcna 1420531 n/a 1420532 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection P49918:p.Phe276Val mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false UniProt FTId: VAR_068850 region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P49918:p.Lys278Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false UniProt FTId: VAR_068851 n/a 1420533 unspecified role unspecified role prey prey physical association physical association false false false 4C