IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jung-2011a-4 Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving GSK beta and pre-phosphorylated RCAN1 cannot be included as the species of GSK beta is not stated. (In these experiments some background/residual phosphorylation of GST-RCAN1 by Dyrk1A is observed.) Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease jung-2011a-1 Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease jung-2011a-2 Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease jung-2011a-3 Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease jung-2011a-5 Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease jung-2011a-6 Regulation of RCAN1 protein activity by Dyrk1A protein-mediated phosphorylation. rat-cortical_neuron Rat cortical Neurons brain-cortex_neuron Cerebral cortical neuron fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Jung M.S., Park J.H., Ryu Y.S., Choi S.H., Yoon S.H., Kwen M.Y., Oh J.Y., Song W.J., Chung S.H. Parkinsons - Interactions investigated in the context of Parkinsons disease Interactions involving CALN (calcineurin) cannot be included as the antibody specificity/identity of the molecule is unknown. The identity of GSKbeta is also not known. wjsong@inje.ac.kr,sulchung@inje.ac.kr J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Alzheimers - Interactions investigated in the context of Alzheimers disease p53805-2 Calcipressin-1 RCAN1 ADAPT78 CSP1 DSC1 DSCR1 Adapt78 Down syndrome critical region protein 1 Myocyte-enriched calcineurin-interacting protein 1 Regulator of calcineurin 1 CALP1-S protein protein human Homo sapiens Human MHFRNFNYSFSSLIACVANSDIFSESETRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS dyr1a_mouse Dual specificity tyrosine-phosphorylation-regulated kinase 1A Dyrk1a Dyrk Protein kinase minibrain homolog MP86 Dual specificity YAK1-related kinase protein protein mouse Mus musculus Mouse MHTGGETSACKPSSVRLAPSFSFHAAGLQMAAQMPHSHQYSDRRQPSISDQQVSALPYSDQIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWSLKKTKDGKREYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGGHFAAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHHHHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLAMRQGADREESPMTGVCVQQSPVASS rcan1_mouse Calcipressin-1 Regulator of calcineurin 1 Down syndrome critical region protein 1 homolog Myocyte-enriched calcineurin-interacting protein 1 Rcan1 Dscr1 protein protein mouse Mus musculus Mouse MEDGVAGPRLGEVAEAVEARAPRRVTLRPFAPFSAAAEGDGGGGGDWSFIDCEMEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDTTFQYFKSFKRVRINFSNPLSAADARLRLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQENEEEEEEMERMKRPKPKIIQTRRPEYTPIHLS dyr1a_rat Dual specificity tyrosine-phosphorylation-regulated kinase 1A Dyrk1a Dyrk Dual specificity YAK1-related kinase Protein kinase minibrain homolog RP86 protein protein rat Rattus norvegicus (Rat) Rat MHTGGETSACKPSSVRLAPSFSFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWSLKKTKDGKREYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGGHFAAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHHHHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS mint homomint May play a role in a signaling pathway regulating nuclear functions of cell proliferation. Phosphorylates serine, threonine and tyrosine residues in its sequence and in exogenous substrates rcan1_rat Calcipressin-1 Dscr1 Down syndrome critical region protein 1 homolog Rcan1 Myocyte-enriched calcineurin-interacting protein 1 Regulator of calcineurin 1 protein protein rat Rattus norvegicus (Rat) Rat MHFRDFNYNFSSLIACVANGDVFSESETRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPLSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEEEEEEEEEMERMKRPKPKIIQTRRPEYTPIHLS dyrk1a-rcan1-2 1451416 n/a 1451422 enzyme target enzyme target substrate substrate neutral component neutral component P53805-2:p.Ser112Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P53805-2:p.Thr192Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P53805-2:p.[Ser112Ala;Thr192Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n_terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1451423 enzyme enzyme neutral component neutral component Q61214:p.Tyr321Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Fig. 2A/B dyrk1a-2 1451416 n/a 1451423 enzyme enzyme neutral component neutral component Q61214:p.Tyr321Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Fig. 2A dyrk1a-rcan1-3 1451416 n/a 1451422 enzyme target enzyme target substrate substrate neutral component neutral component P53805-2:p.Ser112Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P53805-2:p.Thr192Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1451423 enzyme enzyme neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Fig. 3 dyrk1a-rcan1 1451417 n/a 1451423 unspecified role unspecified role bait bait n/a 1451422 unspecified role unspecified role prey prey physical association physical association false false false 1A rcan1-dyrk1a 1451417 n/a 1451423 unspecified role unspecified role prey prey n/a 1451422 unspecified role unspecified role bait bait physical association physical association false false false 1A dyrk1a-rcan1-1 1451418 n/a 1451424 unspecified role unspecified role prey prey n/a 1451423 unspecified role unspecified role bait bait physical association physical association false false false 1B rcan1-dyrk1a-1 1451418 n/a 1451423 unspecified role unspecified role prey prey n/a 1451424 unspecified role unspecified role bait bait physical association physical association false false false 1B rcan1-dyrk1a-2 1451419 n/a 1451423 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) n/a 1451422 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 1C dyrk1a-rcan1-4 1451420 n/a 1451425 unspecified role unspecified role neutral component neutral component n/a 1451426 unspecified role unspecified role neutral component neutral component possible_phospho_193thr opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 7A dyrk1a-rcan1-5 1451421 n/a 1451425 unspecified role unspecified role neutral component neutral component n/a 1451426 unspecified role unspecified role neutral component neutral component possible_phospho_193thr opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 7B, Supp fig 6.