HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html yamauchi-2011a-1 Characterization of plasma triiodophenol binding proteins in vertebrates and tissue distribution of triiodophenol in Rana catesbeiana tadpoles. in vitro In vitro competition binding competition binding weight by staining molecular weight estimation by staining weight by staining Yamauchi K., Sai G. sbkyama@ipc.shizuoka.ac.jp Comp. Biochem. Physiol. C Toxicol. Pharmacol. (1532-0456) 2011 imex curation Only protein-protein interactions imex curation chebi:230446 2,4,6-triiodophenol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tthy_chick Transthyretin TTR Prealbumin TBPA protein protein chick Gallus gallus (Chicken) Chicken MAFHSTLLVFLAGLVFLSEAAPLVSHGSVDSKCPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVSDPQE tthy_pig Transthyretin TTR Prealbumin protein protein pig Sus scrofa (Pig) Pig MASYRLLLLCLAGLVFVSEAGPAGAGESKCPLMVKVLDAVRGSPAVNVGVKVFKKAADGTWEPFALGKTSEFGELHGLTTDEKFVEGIYKVELDTKSYWKALGISPFHEYAEVVFTANDSGRRHYTIAALLSPYSYSTTALVSSPKEGAL tthy_rat Transthyretin Ttr Tt Prealbumin TBPA protein protein rat Rattus norvegicus (Rat) Rat MASLRLFLLCLAGLIFASEAGPGGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTADGSWEPFASGKTAESGELHGLTTDEKFTEGVYRVELDTKSYWKALGISPFHEYAEVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN chebi_230446-ttr-3 1389118 n/a I125-TIP 1389119 unspecified role unspecified role neutral component neutral component i125-tip 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a TTR 1389120 unspecified role unspecified role neutral component neutral component chick-serum Chick serum serum Serum physical association physical association false false false 3 chebi_230446-ttr-1 1389118 n/a I125-TIP 1389119 unspecified role unspecified role neutral component neutral component i125-tip 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a TTR 1389121 unspecified role unspecified role neutral component neutral component pig-serum Pig serum serum Serum physical association physical association false false false 3 chebi_230446-ttr-2 1389118 n/a I125-TIP 1389119 unspecified role unspecified role neutral component neutral component i125-tip 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a TTR 1389122 unspecified role unspecified role neutral component neutral component rat-serum Rat serum serum Serum physical association physical association false false false 3 chebi_2304-chebi_230-1 1389118 n/a TIP 1389119 competitor competitor competitor neutral component neutral component n/a TIP 1389119 unspecified role unspecified role neutral component neutral component i125-tip 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a TTR 1389120 unspecified role unspecified role neutral component neutral component chick-serum Chick serum serum Serum physical association physical association false false false 3 chebi_230-chebi_23-2 1389118 n/a TIP 1389119 competitor competitor competitor neutral component neutral component n/a TIP 1389119 unspecified role unspecified role neutral component neutral component i125-tip 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a TTR 1389121 unspecified role unspecified role neutral component neutral component pig-serum Pig serum serum Serum physical association physical association false false false 3 chebi_230-chebi_23-1 1389118 n/a TIP 1389119 unspecified role unspecified role neutral component neutral component i125-tip 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a TIP 1389119 competitor competitor competitor neutral component neutral component n/a TTR 1389122 unspecified role unspecified role neutral component neutral component rat-serum Rat serum serum Serum physical association physical association false false false 3