IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ trotter-2009-2 The CsdA cysteine desulphurase promotes Fe/S biogenesis by recruiting Suf components and participates to a new sulphur transfer pathway by recruiting CsdL (ex-YgdL), a ubiquitin-modifying-like protein. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast lexa b52 complement lexa b52 complementation LexA B52 transcription complementation lexa b52 complement predetermined predetermined participant predetermined Trotter V., Vinella D., Loiseau L., Ollagnier de Choudens S., Fontecave M., Barras F. The participants of the purified CsdE-TAP-tagged complex were visualised by SDS-PAGE and Coomassie staining. The bands were excised, alkylated, trypsinised and analysed by MALDI-TOF mass spectrometry. barras@ifr88.cnrs-mrs.fr Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation trotter-2009-3 The CsdA cysteine desulphurase promotes Fe/S biogenesis by recruiting Suf components and participates to a new sulphur transfer pathway by recruiting CsdL (ex-YgdL), a ubiquitin-modifying-like protein. in vitro In vitro sulfertransferase sulfurtransferase assay sulfertransferase weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Trotter V., Vinella D., Loiseau L., Ollagnier de Choudens S., Fontecave M., Barras F. The participants of the purified CsdE-TAP-tagged complex were visualised by SDS-PAGE and Coomassie staining. The bands were excised, alkylated, trypsinised and analysed by MALDI-TOF mass spectrometry. barras@ifr88.cnrs-mrs.fr Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation trotter-2009-1 The CsdA cysteine desulphurase promotes Fe/S biogenesis by recruiting Suf components and participates to a new sulphur transfer pathway by recruiting CsdL (ex-YgdL), a ubiquitin-modifying-like protein. ecoli Escherichia coli (strain K12) anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Trotter V., Vinella D., Loiseau L., Ollagnier de Choudens S., Fontecave M., Barras F. The participants of the purified CsdE-TAP-tagged complex were visualised by SDS-PAGE and Coomassie staining. The bands were excised, alkylated, trypsinised and analysed by MALDI-TOF mass spectrometry. barras@ifr88.cnrs-mrs.fr Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation csde_ecoli Sulfur acceptor protein CsdE csdE ygdK JW2782 b2811 protein protein ecoli Escherichia coli (strain K12) MTNPQFAGHPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAGCENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELGLRAQLSASRSQGLNALSEAIIAATKQV tcda_ecoli tRNA threonylcarbamoyladenosine dehydratase tcdA csdL t(6)A37 dehydratase ygdL JW2783 b2812 protein protein ecoli Escherichia coli (strain K12) MSVVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSVGYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAKLRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPQSDGTVCAMKATAEGPKRMDCASGFGAATMVTATFGFVAVSHALKKMMAKAARQG csda_ecoli Cysteine desulfurase CsdA Cysteine sulfinate desulfinase Selenocysteine lyase csdA b2810 ygdJ JW2781 protein protein ecoli Escherichia coli (strain K12) MNVFNPAQFRAQFPALQDAGVYLDSAATALKPEAVVEATQQFYSLSAGNVHRSQFAEAQRLTARYEAAREKVAQLLNAPDDKTIVWTRGTTESINMVAQCYARPRLQPGDEIIVSVAEHHANLVPWLMVAQQTGAKVVKLPLNAQRLPDVDLLPELITPRSRILALGQMSNVTGGCPDLARAITFAHSAGMVVMVDGAQGAVHFPADVQQLDIDFYAFSGHKLYGPTGIGVLYGKSELLEAMSPWLGGGKMVHEVSFDGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLADYDINQAESWSRSLATLAEDALAKRPGFRSFRCQDSSLLAFDFAGVHHSDMVTLLAEYGIALRAGQHCAQPLLAELGVTGTLRASFAPYNTKSDVDALVNAVDRALELLVD dnak_ecoli Chaperone protein DnaK dnaK groP grpF seg b0014 Heat shock protein 70 Heat shock 70 kDa protein HSP70 JW0013 protein protein ecoli Escherichia coli (strain K12) MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVKDKK kprs_ecoli Ribose-phosphate pyrophosphokinase prs prsA b1207 Phosphoribosyl pyrophosphate synthase JW1198 5-phospho-D-ribosyl alpha-1-diphosphate Phosphoribosyl diphosphate synthase protein protein ecoli Escherichia coli (strain K12) MPDMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCAPTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVGVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAIAKLLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKRVFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLSDEIKSLPNVRTLTLSGMLAEAIRRISNEESISAMFEH csde-tcda-1 1458685 n/a 1458688 unspecified role unspecified role bait bait n-terminal lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1458689 unspecified role unspecified role prey prey n-terminal b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2 tcda-csde 1458685 n/a 1458688 unspecified role unspecified role prey prey n-terminal b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1458689 unspecified role unspecified role bait bait n-terminal lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2 tcda-tcda 1458685 n/a 1458689 unspecified role unspecified role bait bait n-terminal lexa dna bd lexa dna binding domain lexa dna bd n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1458689 unspecified role unspecified role prey prey n-terminal b42 ad b42 activation domain b42 ad n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2 csda-csde-tcda 1458686 n/a 1458688 ancillary ancillary neutral component neutral component n/a 1458689 acceptor acceptor neutral component neutral component n/a 1458690 donor donor neutral component neutral component 35s radiolabel l-cysteine persulfide L-cysteine persulfide (R)-2-amino-3-disulfanylpropanoic acid 2-amino-3-disulfanylpropanoic acid 2-amino-3-hydrodisulfidopropanoic acid 2-amino-3-hydropersulfidopropanoic acid 2-amino-3-persulfhydrylpropanoic acid 3-(thiosulfeno)-alanine 3-disulfanylalanine ACT_SITE Cysteine persulfide intermediate L-cysteine persulfide MOD_RES Cysteine persulfide S-mercaptocysteine S-sulfanylcysteine thiocysteine Sulfide persulfide undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sulfurtransfer sulfurtransfer reaction sulfurtransfer false false false Fig. 3 DTT Q46927 Cys-?-[35S]-SH L-cysteine persulfide csda-csde-1 1458686 n/a 1458690 donor donor neutral component neutral component 35s radiolabel l-cysteine persulfide L-cysteine persulfide (R)-2-amino-3-disulfanylpropanoic acid 2-amino-3-disulfanylpropanoic acid 2-amino-3-hydrodisulfidopropanoic acid 2-amino-3-hydropersulfidopropanoic acid 2-amino-3-persulfhydrylpropanoic acid 3-(thiosulfeno)-alanine 3-disulfanylalanine ACT_SITE Cysteine persulfide intermediate L-cysteine persulfide MOD_RES Cysteine persulfide S-mercaptocysteine S-sulfanylcysteine thiocysteine Sulfide persulfide undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1458688 acceptor acceptor neutral component neutral component sulfurtransfer sulfurtransfer reaction sulfurtransfer false false false Fig. 3 P0AGF2 Cys-?-[35S]-SH L-cysteine persulfide csda-tcda-1 1458686 n/a 1458689 acceptor acceptor neutral component neutral component n/a 1458690 donor donor neutral component neutral component 35s radiolabel l-cysteine persulfide L-cysteine persulfide (R)-2-amino-3-disulfanylpropanoic acid 2-amino-3-disulfanylpropanoic acid 2-amino-3-hydrodisulfidopropanoic acid 2-amino-3-hydropersulfidopropanoic acid 2-amino-3-persulfhydrylpropanoic acid 3-(thiosulfeno)-alanine 3-disulfanylalanine ACT_SITE Cysteine persulfide intermediate L-cysteine persulfide MOD_RES Cysteine persulfide S-mercaptocysteine S-sulfanylcysteine thiocysteine Sulfide persulfide undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sulfurtransfer sulfurtransfer reaction sulfurtransfer false false false Fig. 3 Q46927 Cys-?-[35S]-SH L-cysteine persulfide csde-csda 1458687 n/a 1458691 unspecified role unspecified role prey prey n/a 1458690 unspecified role unspecified role prey prey n/a 1458689 unspecified role unspecified role prey prey n/a 1458692 unspecified role unspecified role prey prey n/a 1458688 unspecified role unspecified role bait bait n-terminal tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 1